Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine A1 receptor
LigandBDBM50062858
Substrate/Competitorn/a
Meas. Tech.ChEMBL_29122
Ki 0.094±n/a nM
Citation Holschbach, MHFein, TKrummeich, CLewis, RGWutz, WSchwabe, UUnterlugauer, DOlsson, RA A1 adenosine receptor antagonists as ligands for positron emission tomography (PET) and single-photon emission tomography (SPET). J Med Chem41:555-63 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine A1 receptor
Name:Adenosine A1 receptor
Synonyms:ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low
Type:Enzyme Catalytic Domain
Mol. Mass.:36602.99
Organism:BOVINE
Description:ADENOSINE 0 BOVINE::P28190
Residue:326
Sequence:
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPRTYFHTCLKVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
PRRAVVAITGCWILSFVVGLTPMFGWNNLSAVERDWLANGSVGEPVIECQFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYMEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHMPRILIYIAIFLSHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPVDEDAPAERPDD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50062858
NameBDBM50062858
Synonyms:8-Cyclopentyl-3-(2-fluoro-propyl)-1-propyl-3,7-dihydro-purine-2,6-dione | CHEMBL152026
TypeSmall organic molecule
Emp. Form.C16H23FN4O2
Mol. Mass.322.3778
SMILESCCCn1c(=O)n(CC(C)F)c2nc([nH]c2c1=O)C1CCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a