Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlcohol dehydrogenase
LigandBDBM50064278
Substrate/Competitorn/a
Meas. Tech.ChEMBL_31168
Ki 2300±n/a nM
Citation Schindler, JFBerst, KBPlapp, BV Inhibition of human alcohol dehydrogenases by formamides. J Med Chem41:1696-701 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alcohol dehydrogenase
Name:Alcohol dehydrogenase
Synonyms:Alcohol dehydrogenase 1A | Alcohol dehydrogenase alpha chain | Alcohol dehydrogenase subunit alpha
Type:PROTEIN
Mol. Mass.:39866.36
Organism:Homo sapiens (Human)
Description:ChEMBL_31168
Residue:375
Sequence:
MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAVGICGTDDHVVSGTMVT
PLPVILGHEAAGIVESVGEGVTTVKPGDKVIPLAIPQCGKCRICKNPESNYCLKNDVSNP
QGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTG
YGSAVNVAKVTPGSTCAVFGLGGVGLSAIMGCKAAGAARIIAVDINKDKFAKAKELGATE
CINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPDSQ
NLSMNPMLLLTGRTWKGAILGGFKSKECVPKLVADFMAKKFSLDALITHVLPFEKINEGF
DLLHSGKSIRTILMF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50064278
NameBDBM50064278
Synonyms:CHEMBL46778 | N-Cyclohexylformamid | N-Zyklohexylformamid | N-cyclohexylformamide | formamidocyclohexane
TypeSmall organic molecule
Emp. Form.C7H13NO
Mol. Mass.127.1842
SMILESO=CNC1CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a