Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCerebral cortex alpha adrenergic receptor
LigandBDBM50064577
Substrate/Competitorn/a
Meas. Tech.ChEMBL_33583
IC50 20±n/a nM
Citation Taverne, TDiouf, ODepreux, PPoupaert, JHLesieur, DGuardiola-Lemaître, BRenard, PRettori, MCCaignard, DHPfeiffer, B Novel benzothiazolin-2-one and benzoxazin-3-one arylpiperazine derivatives with mixed 5HT1A/D2 affinity as potential atypical antipsychotics. J Med Chem41:2010-8 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cerebral cortex alpha adrenergic receptor
Name:Cerebral cortex alpha adrenergic receptor
Synonyms:Alpha 1A-adrenoceptor | Alpha 1A-adrenoreceptor | Alpha-1C adrenergic receptor | Cerebral cortex alpha adrenergic receptor | adrenergic Alpha1
Type:Enzyme Catalytic Domain
Mol. Mass.:51492.08
Organism:CALF
Description:adrenergic Alpha1 0 CALF
Residue:466
Sequence:
MVFLSGNASDSSNCTHPPPPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNVWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQKRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINE
EPGYVLFSALGSFYVPLTIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
AQVGGSGVTSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FRPSETVFKIAFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRKQSSKHTLGYTL
HAPSHVLEGQHKDLVRIPVGSAETFYKISKTDGVCEWKIFSSLPRGSARMAVARDPSACT
TARVRSKSFLQVCCCLGPSTPSHGENHQIPTIKIHTISLSENGEEV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50064577
NameBDBM50064577
Synonyms:7-{4-[4-(2-Methoxy-phenyl)-piperazin-1-yl]-butyl}-4-methyl-4H-benzo[1,4]oxazin-3-one | CHEMBL59823
TypeSmall organic molecule
Emp. Form.C24H31N3O3
Mol. Mass.409.5212
SMILESCOc1ccccc1N1CCN(CCCCc2ccc3N(C)C(=O)COc3c2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a