Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin 1B/1D receptor
LigandBDBM50064587
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1771
IC50 20±n/a nM
Citation Taverne, TDiouf, ODepreux, PPoupaert, JHLesieur, DGuardiola-Lemaître, BRenard, PRettori, MCCaignard, DHPfeiffer, B Novel benzothiazolin-2-one and benzoxazin-3-one arylpiperazine derivatives with mixed 5HT1A/D2 affinity as potential atypical antipsychotics. J Med Chem41:2010-8 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serotonin 1B/1D receptor
Name:Serotonin 1B/1D receptor
Synonyms:5-HT-1B | 5-HT1B | 5-hydroxytryptamine receptor 1B (5HT1B) | Serotonin 1 (5-HT1) receptor | Serotonin receptor 1B
Type:Protein
Mol. Mass.:43173.33
Organism:Rattus norvegicus (Rat)
Description:P28564
Residue:386
Sequence:
MEEQGIQCAPPPPATSQTGVPLANLSHNCSADDYIYQDSIALPWKVLLVALLALITLATT
LSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDF
WLSSDITCCTASIMHLCVIALDRYWAITDAVDYSAKRTPKRAAIMIVLVWVFSISISLPP
FFWRQAKAEEEVLDCFVNTDHVLYTVYSTVGAFYLPTLLLIALYGRIYVEARSRILKQTP
NKTGKRLTRAQLITDSPGSTSSVTSINSRVPEVPSESGSPVYVNQVKVRVSDALLEKKKL
MAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHMAIFDFFNWLGYLNSLI
NPIIYTMSNEDFKQAFHKLIRFKCTG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50064587
NameBDBM50064587
Synonyms:6-{2-[4-(2-Methoxy-phenyl)-piperazin-1-yl]-ethyl}-3H-benzothiazol-2-one | CHEMBL60885
TypeSmall organic molecule
Emp. Form.C20H23N3O2S
Mol. Mass.369.481
SMILESCOc1ccccc1N1CCN(CCc2ccc3[nH]c(=O)sc3c2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a