Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 protease
LigandBDBM50065065
Substrate/Competitorn/a
Meas. Tech.ChEMBL_157733
Ki 0.039±n/a nM
Citation De Lucca, GVKim, UTLiang, JCordova, BKlabe, RMGarber, SBacheler, LTLam, GNWright, MRLogue, KAErickson-Viitanen, SKo, SSTrainor, GL Nonsymmetric P2/P2' cyclic urea HIV protease inhibitors. Structure-activity relationship, bioavailability, and resistance profile of monoindazole-substituted P2 analogues. J Med Chem41:2411-23 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 protease
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50065065
NameBDBM50065065
Synonyms:(4R,5S,6S,7R)-4,7-Dibenzyl-5,6-dihydroxy-1-(1H-indazol-5-ylmethyl)-3-(3-methylamino-benzyl)-[1,3]diazepan-2-one | CHEMBL311724
TypeSmall organic molecule
Emp. Form.C35H37N5O3
Mol. Mass.575.7
SMILESCNc1cccc(CN2[C@H](Cc3ccccc3)[C@H](O)[C@@H](O)[C@@H](Cc3ccccc3)N(Cc3ccc4[nH]ncc4c3)C2=O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a