Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuropeptide Y receptor type 1
LigandBDBM50065482
Substrate/Competitorn/a
Meas. Tech.ChEMBL_143830
Ki 7020±n/a nM
Citation Zarrinmayeh, HNunes, AMOrnstein, PLZimmerman, DMArnold, MBSchober, DAGackenheimer, SLBruns, RFHipskind, PABritton, TCCantrell, BEGehlert, DR Synthesis and evaluation of a series of novel 2-[(4-chlorophenoxy)methyl]benzimidazoles as selective neuropeptide Y Y1 receptor antagonists. J Med Chem41:2709-19 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Neuropeptide Y receptor type 1
Name:Neuropeptide Y receptor type 1
Synonyms:NPY-Y1 | NPY1-R | neuropeptide Y receptor Y1
Type:Enzyme Catalytic Domain
Mol. Mass.:44399.07
Organism:Homo sapiens (Human)
Description:NPY-Y1 NPY1R HUMAN::P25929
Residue:384
Sequence:
MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLA
LIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQ
CVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMT
DEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKR
RNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNL
LFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVS
KTSLKQASPVAFKKINNNDDNEKI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50065482
NameBDBM50065482
Synonyms:2-(4-Chloro-phenoxymethyl)-1-(3-piperidin-1-yl-propyl)-1H-benzoimidazole | CHEMBL316291
TypeSmall organic molecule
Emp. Form.C22H26ClN3O
Mol. Mass.383.914
SMILESClc1ccc(OCc2nc3ccccc3n2CCCN2CCCCC2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a