Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlycogen Phosphorylase (PYGL)
LigandBDBM50065945
Substrate/Competitorn/a
Meas. Tech.ChEMBL_99040
IC50 260±n/a nM
Citation Hoover, DJLefkowitz-Snow, SBurgess-Henry, JLMartin, WHArmento, SJStock, IAMcPherson, RKGenereux, PEGibbs, EMTreadway, JL Indole-2-carboxamide inhibitors of human liver glycogen phosphorylase. J Med Chem41:2934-8 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glycogen Phosphorylase (PYGL)
Name:Liver glycogen phosphorylase
Synonyms:Glycogen Phosphorylase, liver form
Type:Homodimer
Mol. Mass.:97153.98
Organism:Homo sapiens (Human)
Description:Dimers associate into a tetramer to form the enzymatically active phosphorylase A.
Residue:847
Sequence:
MAKPLTDQEKRRQISIRGIVGVENVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTV
RDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDI
EELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQVEEA
DDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVPGYMNNTVN
TMRLWSARAPNDFNLRDFNVGDYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFV
VAATLQDIIRRFKASKFGSTRGAGTVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKL
PWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFP
KDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKF
QNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQ
ENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFV
PRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPA
TDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVA
ALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEA
YVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPSDLKISLSNE
SNKVNGN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50065945
NameBDBM50065945
Synonyms:5-Chloro-1H-indole-2-carboxylic acid ((R)-1-dimethylcarbamoyl-2-phenyl-ethyl)-amide | CHEMBL316598
TypeSmall organic molecule
Emp. Form.C20H20ClN3O2
Mol. Mass.369.845
SMILESCN(C)C(=O)[C@@H](Cc1ccccc1)NC(=O)c1cc2cc(Cl)ccc2[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a