Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMetabotropic glutamate receptor 6 (mGlu6)
LigandBDBM50069349
Substrate/Competitorn/a
Meas. Tech.ChEMBL_104457
EC50>1000000±n/a nM
Citation Kozikowski, APSteensma, DVarasi, MPshenichkin, SSurina, EWroblewski, JT alpha-substituted quisqualic acid analogs: new metabotropic glutamate receptor group II selective antagonists. Bioorg Med Chem Lett8:447-52 (1999) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Metabotropic glutamate receptor 6 (mGlu6)
Name:Metabotropic glutamate receptor 6 (mGlu6)
Synonyms:GRM6 | mGlu6 | mGluR6 | metabotropic glutamate 6
Type:Enzyme
Mol. Mass.:95095.82
Organism:Rattus norvegicus (Rat)
Description:P35349
Residue:871
Sequence:
MGRLPVLLLWLAWWLSQAGIACGAGSVRLAGGLTLGGLFPVHARGAAGRACGALKKEQGV
HRLEAMLYALDRVNADPELLPGVRLGARLLDTCSRDTYALEQALSFVQALIRGRGDGDEA
SVRCPGGVPPLRSAPPERVVAVVGASASSVSIMVANVLRLFAIPQISYASTAPELSDSTR
YDFFSRVVPPDSYQAQAMVDIVRALGWNYVSTLASEGNYGESGVEAFVQISREAGGVCIA
QSIKIPREPKPGEFHKVIRRLMETPNARGIIIFANEDDIRRVLEATRQANLTGHFLWVGS
DSWGSKISPILNLEEEAVGAITILPKRASIDGFDQYFMTRSLENNRRNIWFAEFWEENFN
CKLTSSGGQSDDSTRKCTGEERIGQDSAYEQEGKVQFVIDAVYAIAHALHSMHQALCPGH
TGLCPAMEPTDGRTLLHYIRAVRFNGSAGTPVMFNENGDAPGRYDIFQYQATNGSASSGG
YQAVGQWAEALRLDMEVLRWSGDPHEVPPSQCSLPCGPGERKKMVKGVPCCWHCEACDGY
RFQVDEFTCEACPGDMRPTPNHTGCRPTPVVRLTWSSPWAALPLLLAVLGIMATTTIMAT
FMRHNDTPIVRASGRELSYVLLTGIFLIYAITFLMVAEPCAAICAARRLLLGLGTTLSYS
ALLTKTNRIYRIFEQGKRSVTPPPFISPTSQLVITFGLTSLQVVGVIAWLGAQPPHSVID
YEEQRTVDPEQARGVLKCDMSDLSLIGCLGYSLLLMVTCTVYAIKARGVPETFNEAKPIG
FTMYTTCIIWLAFVPIFFGTAQSAEKIYIQTTTLTVSLSLSASVSLGMLYVPKTYVILFH
PEQNVQKRKRSLKKTSTMAAPPQNENAEDAK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50069349
NameBDBM50069349
Synonyms:(S)-2-Amino-2-benzyl-3-(3,5-dioxo-[1,2,4]oxadiazolidin-2-yl)-propionic acid | CHEMBL140862
TypeSmall organic molecule
Emp. Form.C12H13N3O5
Mol. Mass.279.2487
SMILESN[C@@](Cc1ccccc1)(Cn1oc(=O)[nH]c1=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a