Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine D2 receptor/Serotonin 2 (5-HT2) receptor
LigandBDBM50073610
Substrate/Competitorn/a
Meas. Tech.ChEMBL_61419
IC50 880±n/a nM
Citation Perrone, RBerardi, FColabufo, NALeopoldo, MTortorella, V 1-aryl-4-[(5-methoxy-1,2,3, 4-tetrahydronaphthalen-1-yl)alkyl]piperazines and their analogues: influence of the stereochemistry of the tetrahydronaphthalen-1-yl nucleus on 5-HT1A receptor affinity and selectivity versus alpha1 and D2 receptors. 5. J Med Chem42:490-6 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dopamine D2 receptor/Serotonin 2 (5-HT2) receptor
Name:Dopamine D2 receptor and Serotonin 2a receptor (D2 and 5HT2a)
Synonyms:DOPAMINE D2 | DOPAMINE D2 Long | DOPAMINE D2 Short | DOPAMINE D2/D4 | DRD2 | Dopamine D2 receptor | Dopamine2-like
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:50931.60
Organism:Rattus norvegicus (rat)
Description:Receptor binding assays were performed using rat striatal membranes.
Residue:444
Sequence:
MDPLNLSWYDDDLERQNWSRPFNGSEGKADRPHYNYYAMLLTLLIFIIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMS
RRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNS
AVNPIIYTTFNIEFRKAFMKILHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50073610
NameBDBM50073610
Synonyms:1-[3-((R)-5-Methoxy-1,2,3,4-tetrahydro-naphthalen-1-yl)-propyl]-4-phenyl-piperazine | CHEMBL147963
TypeSmall organic molecule
Emp. Form.C24H32N2O
Mol. Mass.364.5237
SMILESCOc1cccc2[C@@H](CCCN3CCN(CC3)c3ccccc3)CCCc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a