Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMatrix metalloproteinase-9 (MMP-9)
LigandBDBM50073902
Substrate/Competitorn/a
Meas. Tech.ChEMBL_105232
IC50 121±n/a nM
Citation Fink, CACarlson, JEBoehm, CMcTaggart, PQiao, YDoughty, JGanu, VMelton, RGoldberg, R Design and synthesis of thiol containing inhibitors of matrix metalloproteinases. Bioorg Med Chem Lett9:195-200 (1999) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Matrix metalloproteinase-9 (MMP-9)
Name:Matrix metalloproteinase-9 (MMP-9)
Synonyms:Matrix metalloproteinase 9
Type:n/a
Mol. Mass.:78603.01
Organism:Rattus norvegicus (Rat)
Description:P50282
Residue:708
Sequence:
MSPWQPLLLVLLALGYSFAAPHQRQPTYVVFPRDLKTSNLTDTQLAEDYLYRYGYTRAAQ
MMGEKQSLRPALLMLQKQLSLPQTGELDSETLKAIRSPRCGVPDVGKFQTFDGDLKWHHH
NITYWIQSYTEDLPRDVIDDSFARAFAVWSAVTPLTFTRVYGLEADIVIQFGVAEHGDGY
PFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGAVVPTYFGNANGAPCHFPFTFEGR
SYLSCTTDGRNDGKPWCGTTADYDTDRKYGFCPSENLYTEHGNGDGKPCVFPFIFEGHSY
SACTTKGRSDGYRWCATTANYDQDKADGFCPTRADVTVTGGNSAGEMCVFPFVFLGKQYS
TCTSEGRSDGRLWCATTSNFDADKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALM
YPMYHYHEDSPLHEDDIKGIHHLYGRGSKPDPRPPATTAAEPQPTAPPTMCSTAPPMAYP
TGGPTVAPTGAPSPGPTGPPTAGPSEAPTESSTPDDNPCNVDVFDAIADIQGALHFFKDG
RYWKFSNHGGNQLQGPFLIARTWPAFPSKLNSAFEDPQPKKIFFFLWAQMWVYTGQSVLG
PRSLDKLGLGSEVTLVTGLLPRRGGKALLISRERIWKFDLKSQKVDPQSVTRLDNEFSGV
PWNSHNVFQYQDKAYFCHDKYFWRVSFHNRVNQVDHVAYVTYDLLQCP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50073902
n/a
NameBDBM50073902
Synonyms:4-Ethoxy-1-mercaptomethyl-cyclohexanecarboxylic acid [(S)-2-phenyl-1-(pyridin-2-ylcarbamoyl)-ethyl]-amide | CHEMBL417210
TypeSmall organic molecule
Emp. Form.C24H31N3O3S
Mol. Mass.441.586
SMILESCCO[C@H]1CC[C@](CS)(CC1)C(=O)N[C@@H](Cc1ccccc1)C(=O)Nc1ccccn1 |wU:6.11,14.14,3.2,wD:6.6,(-5.67,-8.22,;-5.67,-6.68,;-4.33,-5.95,;-4.33,-4.41,;-5.65,-3.64,;-5.65,-2.1,;-4.33,-1.33,;-5.67,-.56,;-5.67,.98,;-2.98,-2.1,;-2.98,-3.64,;-2.98,-.56,;-2.98,.98,;-1.66,-1.33,;-.32,-.56,;-.32,.98,;.43,2.33,;-.35,3.65,;.38,4.99,;1.92,5.03,;2.73,3.71,;1.97,2.36,;1.01,-1.33,;1.01,-2.87,;2.34,-.56,;3.67,-1.33,;5,-.56,;6.35,-1.33,;6.33,-2.87,;5,-3.64,;3.67,-2.87,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: