Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAsialoglycoprotein receptor 1
LigandBDBM50074091
Substrate/Competitorn/a
Meas. Tech.ChEMBL_36369
Ki 93±n/a nM
Citation Sliedregt, LARensen, PCRump, ETvan Santbrink, PJBijsterbosch, MKValentijn, ARvan der Marel, GAvan Boom, JHvan Berkel, TJBiessen, EA Design and synthesis of novel amphiphilic dendritic galactosides for selective targeting of liposomes to the hepatic asialoglycoprotein receptor. J Med Chem42:609-18 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Asialoglycoprotein receptor 1
Name:Asialoglycoprotein receptor 1
Synonyms:ASGP-R 1 | ASGPR 1 | Asgr-1 | Asgr1 | HL-1 | Hepatic lectin 1 | mHL-1
Type:PROTEIN
Mol. Mass.:32590.63
Organism:Mus musculus
Description:ChEMBL_36369
Residue:284
Sequence:
MTKDYQDFQHLDNDNDHHQLRRGPPPTPRLLQRLCSGSRLLLLSSSLSILLLVVVCVITS
QNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHS
SLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKY
CQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQP
DNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50074091
NameBDBM50074091
Synonyms:CHEMBL2368208 | Galactoside analogue
TypeSmall organic molecule
Emp. Form.C65H104N8O33
Mol. Mass.1525.5551
SMILESOC[C@@H]1O[C@@H](OCCCCC(=O)NCC(=O)NCCCC(=O)OCC(COC(=O)CCCNC(=O)CNC(=O)CCCCO[C@@H]2O[C@@H](CO)[C@H](O)[C@H](O)[C@@H]2O)(COC(=O)CCCNC(=O)CNC(=O)CCCCO[C@@H]2O[C@@H](CO)[C@H](O)[C@H](O)[C@@H]2O)NC(=O)CNC(=O)OCc2ccccc2)[C@@H](O)[C@@H](O)[C@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a