Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 1B
LigandBDBM50060426
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1617
IC50 1.3±n/a nM
Citation Chambers, MSStreet, LJGoodacre, SHobbs, SCHunt, PJelley, RAMatassa, VGReeve, AJSternfeld, FBeer, MSStanton, JARathbone, DWatt, APMacLeod, AM 3-(Piperazinylpropyl)indoles: selective, orally bioavailable h5-HT1D receptor agonists as potential antimigraine agents. J Med Chem42:691-705 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 1B
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-1B | 5-HT-1D-beta | 5-HT1B | 5-hydroxytryptamine receptor 1B (5-HT1B) | S12 | Serotonin 1D beta receptor | Serotonin Receptor 1B
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:43579.17
Organism:Homo sapiens (Human)
Description:Receptor binding assays were performed using human clone stably expressed in CHO cells
Residue:390
Sequence:
MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALIT
LATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV
VCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISI
SLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIL
KQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE
KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYL
NSLINPIIYTMSNEDFKQAFHKLIRFKCTS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50060426
NameBDBM50060426
Synonyms:CHEMBL296161 | Dimethyl-[2-(5-[1,2,4]triazol-4-yl-1H-indol-3-yl)-ethyl]-amine | L-741604
TypeSmall organic molecule
Emp. Form.C14H17N5
Mol. Mass.255.3183
SMILESCN(C)CCc1c[nH]c2ccc(cc12)-n1cnnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a