Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 1D (5HT1D)
LigandBDBM86708
Substrate/Competitorn/a
Meas. Tech.ChEMBL_3533
Ki 1.1±n/a nM
Citation Lang, LJagoda, ESchmall, BVuong, BKAdams, HRNelson, DLCarson, REEckelman, WC Development of fluorine-18-labeled 5-HT1A antagonists. J Med Chem42:1576-86 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 1D (5HT1D)
Name:5-hydroxytryptamine receptor 1D (5HT1D)
Synonyms:Serotonin 1d (5-HT1d) receptor
Type:Enzyme
Mol. Mass.:41605.88
Organism:Mus musculus (Mouse)
Description:Q61224
Residue:374
Sequence:
MSPPNQSLEGLPQEASNRSLNVTGAWDPEVLQALRISLVVVLSVITLATVLSNAFVLTTI
LLTKKLHTPANYLIGSLATTDLLVSILVMPISIAYTTTRTWNFGQILCDIWVSSDITCCT
ASILHLCVIALDRYWAITDALEYSKRRTAGHAAAMIAAVWIISICISIPPLFWRQATAHE
EMSDCLVNTSQISYTIYSTCGAFYIPSILLIILYGRIYVAARSRILNPPSLYGKRFTTAQ
LITGSAGSSLCSLNPSLHESHTHTVGSPLFFNQVKIKLADSILERKRISAARERKATKTL
GIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPVIYTVFNEDF
RQAFQKVVHFRKIS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM86708
NameBDBM86708
Synonyms:CAS_146714-97-8 | CHEMBL31354 | CHEMBL514874 | CHEMBL537403 | NSC_104911 | WAY 100,635
TypeSmall organic molecule
Emp. Form.C25H34N4O2
Mol. Mass.422.5631
SMILESCOc1ccccc1N1CCN(CCN(C(=O)C2CCCCC2)c2ccccn2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a