Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-lactamase AmpC
LigandBDBM50076673
Substrate/Competitorn/a
Meas. Tech.ChEBML_41204
IC50 120±n/a nM
Citation Bitha, PLi, ZFrancisco, GDRasmussen, BALin, YI 6-(1-Hydroxyalkyl)penam sulfone derivatives as inhibitors of class A and class C beta-lactamases I. Bioorg Med Chem Lett9:991-6 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-lactamase AmpC
Name:Beta-lactamase AmpC
Synonyms:Beta-lactamase | Beta-lactamase (AmpC) | Cephalosporinase | Escherichia coli K-12
Type:Protien
Mol. Mass.:41561.62
Organism:Escherichia coli
Description:P00811
Residue:377
Sequence:
MFKTTLCALLITASCSTFAAPQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWG
YADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGI
TLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVK
PSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVK
STIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSII
NGSDNKIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNY
PNPARVDAAWQILNALQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50076673
NameBDBM50076673
Synonyms:CHEMBL175189 | Sodium; (2S,5R,6R)-6-((S)-1-hydroxy-ethyl)-3,3-dimethyl-4,4,7-trioxo-4lambda*6*-thia-1-aza-bicyclo[3.2.0]heptane-2-carboxylate
TypeSmall organic molecule
Emp. Form.C10H14NO6S
Mol. Mass.276.287
SMILESC[C@H](O)[C@H]1[C@@H]2N([C@@H](C([O-])=O)C(C)(C)S2(=O)=O)C1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a