Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 protease
LigandBDBM50076891
Substrate/Competitorn/a
Meas. Tech.ChEBML_79478
IC50 28000±n/a nM
Citation Kurihara, STsumuraya, TFujii, I Structure-based design of diaminopyranosides as a novel inhibitor core unit of HIV proteases. Bioorg Med Chem Lett9:1179-84 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 protease
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50076891
NameBDBM50076891
Synonyms:CHEMBL278187 | Phenyl-carbamic acid 4,5-diamino-3,6-bis-benzyloxy-tetrahydro-pyran-2-ylmethyl ester
TypeSmall organic molecule
Emp. Form.C27H31N3O5
Mol. Mass.477.5521
SMILESNC1C(N)C(OCc2ccccc2)C(COC(=O)Nc2ccccc2)OC1OCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a