Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC5a anaphylatoxin chemotactic receptor (C5aR)
LigandBDBM50077499
Substrate/Competitorn/a
Meas. Tech.ChEMBL_41606
IC50 300±n/a nM
Citation Finch, AMWong, AKPaczkowski, NJWadi, SKCraik, DJFairlie, DPTaylor, SM Low-molecular-weight peptidic and cyclic antagonists of the receptor for the complement factor C5a. J Med Chem42:1965-74 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C5a anaphylatoxin chemotactic receptor (C5aR)
Name:C5a anaphylatoxin chemotactic receptor
Synonyms:C5a anaphylatoxin chemotactic receptor | C5a-R | C5aR | CD_antigen=CD88
Type:Enzyme
Mol. Mass.:39347.68
Organism:Homo sapiens (Human)
Description:P21730
Residue:350
Sequence:
MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVW
VTAFEAKRTINAIWFLNLAVADFLSCLALPILFTSIVQHHHWPFGGAACSILPSLILLNM
YASILLLATISADRFLLVFKPIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREE
YFPPKVLCGVDYSHDKRRERAVAIVRLVLGFLWPLLTLTICYTFILLRTWSRRATRSTKT
LKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLKKLDSLCVSFAYINCCINPIIY
VVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50077499
NameBDBM50077499
Synonyms:(S)-2-Amino-N-[(5S,12S,15S,18R,20aS)-18-cyclohexylmethyl-12-(2-guanidino-ethyl)-15-(1H-indol-3-ylmethyl)-4,11,14,17,20-pentaoxo-icosahydro-3a,10,13,16,19-pentaaza-cyclopentacyclononadecen-5-yl]-3-phenyl-propionamide | CHEMBL293241
TypeSmall organic molecule
Emp. Form.C45H63N11O6
Mol. Mass.854.0518
SMILESN[C@@H](Cc1ccccc1)C(=O)N[C@H]1CCCCNC(=O)[C@H](CCNC(N)=N)NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC(=O)[C@@H](CC2CCCCC2)NC(=O)[C@@H]2CCCN2C1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a