Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 1B
LigandBDBM50077807
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1618
IC50 3.1±n/a nM
Citation van Niel, MBCollins, IBeer, MSBroughton, HBCheng, SKGoodacre, SCHeald, ALocker, KLMacLeod, AMMorrison, DMoyes, CRO'Connor, DPike, ARowley, MRussell, MGSohal, BStanton, JAThomas, SVerrier, HWatt, APCastro, JL Fluorination of 3-(3-(piperidin-1-yl)propyl)indoles and 3-(3-(piperazin-1-yl)propyl)indoles gives selective human 5-HT1D receptor ligands with improved pharmacokinetic profiles. J Med Chem42:2087-104 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 1B
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-1B | 5-HT-1D-beta | 5-HT1B | 5-hydroxytryptamine receptor 1B (5-HT1B) | S12 | Serotonin 1D beta receptor | Serotonin Receptor 1B
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:43579.17
Organism:Homo sapiens (Human)
Description:Receptor binding assays were performed using human clone stably expressed in CHO cells
Residue:390
Sequence:
MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALIT
LATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV
VCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISI
SLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIL
KQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE
KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYL
NSLINPIIYTMSNEDFKQAFHKLIRFKCTS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50077807
NameBDBM50077807
Synonyms:3-{3-[4-Fluoro-4-(2-fluoro-benzyl)-piperidin-1-yl]-propyl}-5-[1,2,4]triazol-4-yl-1H-indole | CHEMBL65824
TypeSmall organic molecule
Emp. Form.C25H27F2N5
Mol. Mass.435.5122
SMILESFc1ccccc1CC1(F)CCN(CCCc2c[nH]c3ccc(cc23)-n2cnnc2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a