Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMatrix metalloproteinase-7 (MMP7)
LigandBDBM50078936
Substrate/Competitorn/a
Meas. Tech.ChEMBL_105050
Ki 4±n/a nM
Citation Vassiliou, SMucha, ACuniasse, PGeorgiadis, DLucet-Levannier, KBeau, FKannan, RMurphy, GKnäuper, VRio, MCBasset, PYiotakis, ADive, V Phosphinic pseudo-tripeptides as potent inhibitors of matrix metalloproteinases: a structure-activity study. J Med Chem42:2610-20 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Matrix metalloproteinase-7 (MMP7)
Name:Matrix metalloproteinase 7
Synonyms:Matrix metalloproteinase 7 | Matrix metalloproteinase-7 (MMP-7)
Type:Enzyme
Mol. Mass.:29681.54
Organism:Homo sapiens (Human)
Description:P09237
Residue:267
Sequence:
MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLK
EMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDL
PHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAF
APGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGD
PQNFKLSQDDIKGIQKLYGKRSNSRKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50078936
NameBDBM50078936
Synonyms:CHEMBL87786 | {2-[(2-Amino-1-carbamoyl-ethyl)-(2,4-dinitro-phenyl)-carbamoyl]-4-phenyl-butyl}-(1-benzyloxycarbonylamino-2-phenyl-ethyl)-phosphinic acid
TypeSmall organic molecule
Emp. Form.C36H39N6O10P
Mol. Mass.746.7028
SMILESNCC(N(C(=O)C(CCc1ccccc1)C[P+](O)([O-])C(Cc1ccccc1)NC(=O)OCc1ccccc1)c1ccc(cc1[N+]([O-])=O)[N+]([O-])=O)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a