Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcetolactate synthase
LigandBDBM50216776
Substrate/Competitorn/a
Meas. Tech.ChEBML_27494
IC50>100±n/a nM
Citation Liu, JLi, ZYan, HWang, LChen, J The design and synthesis of ALS inhibitors from pharmacophore models. Bioorg Med Chem Lett9:1927-32 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acetolactate synthase
Name:Acetolactate synthase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:72585.19
Organism:Arabidopsis thaliana
Description:ChEMBL_934103
Residue:670
Sequence:
MAAATTTTTTSSSISFSTKPSPSSSKSPLPISRFSLPFSLNPNKSSSSSRRRGIKSSSPS
SISAVLNTTTNVTTTPSPTKPTKPETFISRFAPDQPRKGADILVEALERQGVETVFAYPG
GASMEIHQALTRSSSIRNVLPRHEQGGVFAAEGYARSSGKPGICIATSGPGATNLVSGLA
DALLDSVPLVAITGQVPRRMIGTDAFQETPIVEVTRSITKHNYLVMDVEDIPRIIEEAFF
LATSGRPGPVLVDVPKDIQQQLAIPNWEQAMRLPGYMSRMPKPPEDSHLEQIVRLISESK
KPVLYVGGGCLNSSDELGRFVELTGIPVASTLMGLGSYPCDDELSLHMLGMHGTVYANYA
VEHSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKTPHVSVCGDVKLALQ
GMNKVLENRAEELKLDFGVWRNELNVQKQKFPLSFKTFGEAIPPQYAIKVLDELTDGKAI
ISTGVGQHQMWAAQFYNYKKPRQWLSSGGLGAMGFGLPAAIGASVANPDAIVVDIDGDGS
FIMNVQELATIRVENLPVKVLLLNNQHLGMVMQWEDRFYKANRAHTFLGDPAQEDEIFPN
MLLFAAACGIPAARVTKKADLREAIQTMLDTPGPYLLDVICPHQEHVLPMIPSGGTFNDV
ITEGDGRIKY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50216776
NameBDBM50216776
Synonyms:CHEMBL58689
TypeSmall organic molecule
Emp. Form.C13H12N2O5
Mol. Mass.276.2448
SMILESCOc1ccccc1C(=O)OCn1ccc(=O)[nH]c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a