Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCdc25C
LigandBDBM50080994
Substrate/Competitorn/a
Meas. Tech.ChEMBL_49191
IC50 30000±n/a nM
Citation Blanchard, JLEpstein, DMBoisclair, MDRudolph, JPal, K Dysidiolide and related gamma-hydroxy butenolide compounds as inhibitors of the protein tyrosine phosphatase, CDC25. Bioorg Med Chem Lett9:2537-8 (1999) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Cdc25C
Name:Cdc25C
Synonyms:Dual specificity phosphatase Cdc25C | M-phase inducer phosphatase 3
Type:Substrate
Mol. Mass.:53366.11
Organism:Homo sapiens (Human)
Description:P30307
Residue:473
Sequence:
MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANL
SILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMK
CSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNP
NLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDK
VKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQ
DLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKK
PIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFF
PEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50080994
n/a
NameBDBM50080994
Synonyms:CHEMBL85943 | sodium tungstate
TypeSmall organic molecule
Emp. Form.O4W
Mol. Mass.247.84
SMILES[O-][W]([O-])(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: