Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInducible nitric oxide synthase
LigandBDBM50081587
Substrate/Competitorn/a
Meas. Tech.ChEMBL_144513
IC50 30000±n/a nM
Citation Fröhlich, LGKotsonis, PTraub, HTaghavi-Moghadam, SAl-Masoudi, NHofmann, HStrobel, HMatter, HPfleiderer, WSchmidt, HH Inhibition of neuronal nitric oxide synthase by 4-amino pteridine derivatives: structure-activity relationship of antagonists of (6R)-5,6,7,8-tetrahydrobiopterin cofactor. J Med Chem42:4108-21 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Inducible nitric oxide synthase
Name:Inducible nitric oxide synthase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:30912.72
Organism:Bos taurus
Description:ChEMBL_144513
Residue:275
Sequence:
MACPWQFLFKIKSQKVDLATELDINNNVGKFYQPPSSPVTQDDPKRHSPGKHGNESPQPL
TGTVKTSPESLSKLDAPPSACPRHVRIKNWGSGVTFQDTLHQKAKGDLSCKSKSCLASIM
NPKSLTIGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAQEMFEHICRHVRYATNNGNI
RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50081587
NameBDBM50081587
Synonyms:6-Decyloxymethyl-pteridine-2,4-diamine | CHEMBL98630
TypeSmall organic molecule
Emp. Form.C17H28N6O
Mol. Mass.332.4438
SMILESCCCCCCCCCCOCc1cnc2nc(N)nc(N)c2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a