Target
Retinoic acid receptor gamma
Ligand
BDBM31892
Substrate
n/a
Meas. Tech.
ChEMBL_196667
EC50
6±n/a nM
Citation
 Simoni, DInvidiata, FPRondanin, RGrimaudo, SCannizzo, GBarbusca, EPorretto, FD'Alessandro, NTolomeo, M Structure-activity relationship studies of novel heteroretinoids: induction of apoptosis in the HL-60 cell line by a novel isoxazole-containing heteroretinoid. J Med Chem 42:4961-9 (2000) [PubMed]  Article
Target
Name:
Retinoic acid receptor gamma
Synonyms:
Nuclear receptor subfamily 1 group B member 3 | RAR-gamma | Retinoic acid receptor RXR-alpha/gamma | Retinoic acid receptor gamma | Retinoid receptor
Type:
PROTEIN
Mol. Mass.:
50345.43
Organism:
Homo sapiens (Human)
Description:
ChEMBL_1458016
Residue:
454
Sequence:
MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA
  
Inhibitor
Name:
BDBM31892
Synonyms:
9-cis retinoic acid | 9C-RA | CHEMBL705 | Panretin | alitretinoin
Type:
Small organic molecule
Emp. Form.:
C20H28O2
Mol. Mass.:
300.4351
SMILES:
C\C(\C=C\C1=C(C)CCCC1(C)C)=C\C=C\C(\C)=C\C(O)=O |c:4|
Structure:
Search PDB for entries with ligand similarity: