Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin (5-HT) receptor
LigandBDBM50060429
Substrate/Competitorn/a
Meas. Tech.ChEMBL_3736
IC50 540±n/a nM
Citation Russell, MGMatassa, VGPengilley, RRvan Niel, MBSohal, BWatt, APHitzel, LBeer, MSStanton, JABroughton, HBCastro, JL 3-[3-(Piperidin-1-yl)propyl]indoles as highly selective h5-HT(1D) receptor agonists. J Med Chem42:4981-5001 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serotonin (5-HT) receptor
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-7 | 5-HT-X | 5-HT7 | 5-HT7L | 5-HT7S | 5-Hydroxytryptamine receptor 7 (5-HT7) | 5-hydroxytryptamine receptor 7 | 5-hydroxytryptamine receptor 7 (5-HT-7) | Adrenergic Alpha | GPRFO | HTR7 | Serotonin Receptor 7
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:49852.62
Organism:Rattus norvegicus (rat)
Description:Rat cloned 5-HT7R.
Residue:448
Sequence:
MMDVNSSGRPDLYGHLRSLILPEVGRGLQDLSPDGGAHPVVSSWMPHLLSGFLEVTASPA
PTWDAPPDNVSGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSN
YLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVIS
IDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDF
GYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVQPESVISLNGVVKLQK
EVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTS
CSCIPLWVERTCLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHE
ALKLAERPERSEFVLQNSDHCGKKGHDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50060429
NameBDBM50060429
Synonyms:(R)-2-(4-Fluoro-phenyl)-2-{1-[3-(5-[1,2,4]triazol-4-yl-1H-indol-3-yl)-propyl]-piperidin-4-ylamino}-ethanol | CHEMBL313714
TypeSmall organic molecule
Emp. Form.C26H31FN6O
Mol. Mass.462.5623
SMILESOC[C@H](NC1CCN(CCCc2c[nH]c3ccc(cc23)-n2cnnc2)CC1)c1ccc(F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a