Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin 1B/1D receptor
LigandBDBM50084952
Substrate/Competitorn/a
Meas. Tech.ChEMBL_278
IC50 0.5±n/a nM
Citation Liao, YBöttcher, HHarting, JGreiner, Hvan Amsterdam, CCremers, TSundell, SMärz, JRautenberg, WWikström, H New selective and potent 5-HT(1B/1D) antagonists: chemistry and pharmacological evaluation of N-piperazinylphenyl biphenylcarboxamides and biphenylsulfonamides. J Med Chem43:517-25 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serotonin 1B/1D receptor
Name:Serotonin 1B/1D receptor
Synonyms:5-HT-1B | 5-HT1B | 5-hydroxytryptamine receptor 1B (5HT1B) | Serotonin 1 (5-HT1) receptor | Serotonin receptor 1B
Type:Protein
Mol. Mass.:43173.33
Organism:Rattus norvegicus (Rat)
Description:P28564
Residue:386
Sequence:
MEEQGIQCAPPPPATSQTGVPLANLSHNCSADDYIYQDSIALPWKVLLVALLALITLATT
LSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDF
WLSSDITCCTASIMHLCVIALDRYWAITDAVDYSAKRTPKRAAIMIVLVWVFSISISLPP
FFWRQAKAEEEVLDCFVNTDHVLYTVYSTVGAFYLPTLLLIALYGRIYVEARSRILKQTP
NKTGKRLTRAQLITDSPGSTSSVTSINSRVPEVPSESGSPVYVNQVKVRVSDALLEKKKL
MAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHMAIFDFFNWLGYLNSLI
NPIIYTMSNEDFKQAFHKLIRFKCTG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50084952
NameBDBM50084952
Synonyms:4'-Carbamimidoyl-2'-methyl-biphenyl-4-carboxylic acid [4-methoxy-3-(4-methyl-piperazin-1-yl)-phenyl]-amide | CHEMBL147503
TypeSmall organic molecule
Emp. Form.C27H31N5O2
Mol. Mass.457.5673
SMILESCOc1ccc(NC(=O)c2ccc(cc2)-c2ccc(cc2C)C(N)=N)cc1N1CCN(C)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a