Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 1D
LigandBDBM79215
Substrate/Competitorn/a
Meas. Tech.ChEMBL_279
IC50 52±n/a nM
Citation Liao, YBöttcher, HHarting, JGreiner, Hvan Amsterdam, CCremers, TSundell, SMärz, JRautenberg, WWikström, H New selective and potent 5-HT(1B/1D) antagonists: chemistry and pharmacological evaluation of N-piperazinylphenyl biphenylcarboxamides and biphenylsulfonamides. J Med Chem43:517-25 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 1D
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-1D | 5-HT-1D-alpha | 5-HT1D | 5-hydroxytryptamine receptor 1D (5-HT1D) | Serotonin Receptor 1D
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:41920.63
Organism:Homo sapiens (Human)
Description:Receptor binding assays were performed using human clone stably expressed in CHO cells.
Residue:377
Sequence:
MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALKISLAVVLSVITLATVLSNAFVL
TTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDIT
CCTASILHLCVIALDRYWAITDALEYSKRRTAGHAATMIAIVWAISICISIPPLFWRQAK
AQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYRAARNRILNPPSLYGKRFT
TAHLITGSAGSSLCSLNSSLHEGHSHSAGSPLFFNHVKIKLADSALERKRISAARERKAT
KILGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFN
EEFRQAFQKIVPFRKAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM79215
NameBDBM79215
Synonyms:CHEMBL15928 | GR 127935 | GR 127935 hydrochloride hydrate | MLS002153332 | N-[4-methoxy-3-(4-methyl-1-piperazinyl)phenyl]-4-[2-methyl-4-(5-methyl-1,2,4-oxadiazol-3-yl)phenyl]benzamide;hydrochloride | N-[4-methoxy-3-(4-methylpiperazin-1-yl)phenyl]-4-[2-methyl-4-(5-methyl-1,2,4-oxadiazol-3-yl)phenyl]benzamide;hydrochloride | N-[4-methoxy-3-(4-methylpiperazino)phenyl]-4-[2-methyl-4-(5-methyl-1,2,4-oxadiazol-3-yl)phenyl]benzamide;hydrochloride | SMR001230745 | cid_11497466
TypeSmall organic molecule
Emp. Form.C29H31N5O3
Mol. Mass.497.5881
SMILESCOc1ccc(NC(=O)c2ccc(cc2)-c2ccc(cc2C)-c2noc(C)n2)cc1N1CCN(C)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a