Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin 1B/1D receptor
LigandBDBM50084959
Substrate/Competitorn/a
Meas. Tech.ChEMBL_278
IC50 2±n/a nM
Citation Liao, YBöttcher, HHarting, JGreiner, Hvan Amsterdam, CCremers, TSundell, SMärz, JRautenberg, WWikström, H New selective and potent 5-HT(1B/1D) antagonists: chemistry and pharmacological evaluation of N-piperazinylphenyl biphenylcarboxamides and biphenylsulfonamides. J Med Chem43:517-25 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serotonin 1B/1D receptor
Name:Serotonin 1B/1D receptor
Synonyms:5-HT-1B | 5-HT1B | 5-hydroxytryptamine receptor 1B (5HT1B) | Serotonin 1 (5-HT1) receptor | Serotonin receptor 1B
Type:Protein
Mol. Mass.:43173.33
Organism:Rattus norvegicus (Rat)
Description:P28564
Residue:386
Sequence:
MEEQGIQCAPPPPATSQTGVPLANLSHNCSADDYIYQDSIALPWKVLLVALLALITLATT
LSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDF
WLSSDITCCTASIMHLCVIALDRYWAITDAVDYSAKRTPKRAAIMIVLVWVFSISISLPP
FFWRQAKAEEEVLDCFVNTDHVLYTVYSTVGAFYLPTLLLIALYGRIYVEARSRILKQTP
NKTGKRLTRAQLITDSPGSTSSVTSINSRVPEVPSESGSPVYVNQVKVRVSDALLEKKKL
MAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHMAIFDFFNWLGYLNSLI
NPIIYTMSNEDFKQAFHKLIRFKCTG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50084959
NameBDBM50084959
Synonyms:11'-Methyl-5-[[2'-methyl-4'-(5-methyl-1,2,4-oxadiazol-3-yl)biphenyl-4-yl]carbonyl]-2,3,6,7-tetrahydrospiro[furo-[2,3-f]indole-3,4'-piperidine](SB-224289) | 4-[2-methyl-4-(5-methyl-1,2,4-oxadiazol-3-yl)phenyl]phenyl-1'-methylspiro[3,5,6,7-tetrahydro-2H-furo[2,3-f]indole-3,4'-(hexahydropyridine)]-5-ylmethanone | CHEMBL281350 | SB-224289 | [2'-Methyl-4'-(5-methyl-[1,2,4]oxadiazol-3-yl)-biphenyl-4-yl]-[3-(1-methyl-piperidine)-2,3,6,7-tetrahydro-1-oxa-5-aza-s-indacen-5-yl]-methanone
TypeSmall organic molecule
Emp. Form.C32H32N4O3
Mol. Mass.520.6215
SMILESCN1CCC2(COc3cc4CCN(C(=O)c5ccc(cc5)-c5ccc(cc5C)-c5noc(C)n5)c4cc23)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a