Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR1D
LigandBDBM50086111
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1975
IC50 233±n/a nM
Citation Matzen, Lvan Amsterdam, CRautenberg, WGreiner, HEHarting, JSeyfried, CABöttcher, H 5-HT reuptake inhibitors with 5-HT(1B/1D) antagonistic activity: a new approach toward efficient antidepressants. J Med Chem43:1149-57 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
HTR1D
Name:Serotonin 1B/1D receptor
Synonyms:5-HT-1D | 5-HT1D | 5-hydroxytryptamine receptor 1D | Serotonin 1 (5-HT1) receptor | Serotonin receptor 1D
Type:Enzyme Catalytic Domain
Mol. Mass.:41551.75
Organism:RAT
Description:5-HT1D HTR1D RAT::P28565
Residue:374
Sequence:
MSLPNQSLEGLPQEASNRSLNATGAWDPEVLQALRISLVVVLSIITLATVLSNAFVLTTI
LLTKKLHTPANYLIGSLATTDLLVSILVMPISIAYTTTRTWNFGQILCDIWVSSDITCCT
ASILHLCVIALDRYWAITDALEYSKRRTAGHAAAMIAAVWAISICISIPPLFWRQATAHE
EMSDCLVNTSQISYTIYSTCGAFYIPSILLIILYGRIYVAARSRILNPPSLYGKRFTTAQ
LITGSAGSSLCSLNPSLHESHTHTVGSPLFFNQVKIKLADSILERKRISAARERKATKTL
GIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPVIYTVFNEDF
RQAFQRVVHFRKAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50086111
NameBDBM50086111
Synonyms:4-(1H-Indol-3-yl)-piperidine-1-carboxylic acid [4-methoxy-3-(4-methyl-piperazin-1-yl)-phenyl]-amide | CHEMBL15855
TypeSmall organic molecule
Emp. Form.C26H33N5O2
Mol. Mass.447.5725
SMILESCOc1ccc(NC(=O)N2CCC(CC2)c2c[nH]c3ccccc23)cc1N1CCN(C)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a