Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAMP deaminase 2
LigandBDBM50087325
Substrate/Competitorn/a
Meas. Tech.ChEMBL_28868
Ki 10000±n/a nM
Citation Bookser, BCKasibhatla, SRAppleman, JRErion, MD AMP deaminase inhibitors. 2. Initial discovery of a non-nucleotide transition-state inhibitor series. J Med Chem43:1495-507 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
AMP deaminase 2
Name:AMP deaminase 2
Synonyms:AMP deaminase 2 | AMP deaminase 2 (hAMPD2)
Type:Protein
Mol. Mass.:100694.77
Organism:Homo sapiens (Human)
Description:n/a
Residue:879
Sequence:
MRNRGQGLFRLRSRCFLHQSLPLGAGRRKGLDVAEPGPSRCRSDSPAVAAVVPAMASYPS
GSGKPKAKYPFKKRASLQASTAAPEARGGLGAPPLQSARSLPGPAPCLKHFPLDLRTSMD
GKCKEIAEELFTRSLAESELRSAPYEFPEESPIEQLEERRQRLERQISQDVKLEPDILLR
AKQDFLKTDSDSDLQLYKEQGEGQGDRSLRERDVLEREFQRVTISGEEKCGVPFTDLLDA
AKSVVRALFIREKYMALSLQSFCPTTRRYLQQLAEKPLETRTYEQGPDTPVSADAPVHPP
ALEQHPYEHCEPSTMPGDLGLGLRMVRGVVHVYTRREPDEHCSEVELPYPDLQEFVADVN
VLMALIINGPIKSFCYRRLQYLSSKFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIH
ASSCMNQKHLLRFIKRAMKRHLEEIVHVEQGREQTLREVFESMNLTAYDLSVDTLDVHAD
RNTFHRFDKFNAKYNPIGESVLREIFIKTDNRVSGKYFAHIIKEVMSDLEESKYQNAELR
LSIYGRSRDEWDKLARWAVMHRVHSPNVRWLVQVPRLFDVYRTKGQLANFQEMLENIFLP
LFEATVHPASHPELHLFLEHVDGFDSVDDESKPENHVFNLESPLPEAWVEEDNPPYAYYL
YYTFANMAMLNHLRRQRGFHTFVLRPHCGEAGPIHHLVSAFMLAENISHGLLLRKAPVLQ
YLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEY
SIATQVWKLSSCDMCELARNSVLMSGFSHKVKSHWLGPNYTKEGPEGNDIRRTNVPDIRV
GYRYETLCQELALITQAVQSEMLETIPEEAGITMSPGPQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50087325
NameBDBM50087325
Synonyms:7-(8-Hydroxy-7,8-dihydro-6H-imidazo[4,5-d][1,3]diazepin-3-yl)-heptanoic acid 0.5H2O | CHEMBL37135
TypeSmall organic molecule
Emp. Form.C13H20N4O3
Mol. Mass.280.3229
SMILESOC1CNC=Nc2c1ncn2CCCCCCC(O)=O |c:4|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a