Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAMP deaminase 3 (hAMPD3)
LigandBDBM50087412
Substrate/Competitorn/a
Meas. Tech.ChEMBL_28867
Ki 4200±n/a nM
Citation Bookser, BCKasibhatla, SRErion, MD AMP deaminase inhibitors. 4. Further N3-substituted coformycin aglycon analogues: N3-alkylmalonates as ribose 5'-monophosphate mimetics. J Med Chem43:1519-24 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
AMP deaminase 3 (hAMPD3)
Name:AMP deaminase 3 (hAMPD3)
Synonyms:AMP deaminase 3
Type:Protein
Mol. Mass.:88818.80
Organism:Homo sapiens (Human)
Description:n/a
Residue:767
Sequence:
MPRQFPKLNISEVDEQVRLLAEKVFAKVLREEDSKDALSLFTVPEDCPIGQKEAKERELQ
KELAEQKSVETAKRKKSFKMIRSQSLSLQMPPQQDWKGPPAASPAMSPTTPVVTGATSLP
TPAPYAMPEFQRVTISGDYCAGITLEDYEQAAKSLAKALMIREKYARLAYHRFPRITSQY
LGHPRADTAPPEEGLPDFHPPPLPQEDPYCLDDAPPNLDYLVHMQGGILFVYDNKKMLEH
QEPHSLPYPDLETYTVDMSHILALITDGPTKTYCHRRLNFLESKFSLHEMLNEMSEFKEL
KSNPHRDFYNVRKVDTHIHAAACMNQKHLLRFIKHTYQTEPDRTVAEKRGRKITLRQVFD
GLHMDPYDLTVDSLDVHAGRQTFHRFDKFNSKYNPVGASELRDLYLKTENYLGGEYFARM
VKEVARELEESKYQYSEPRLSIYGRSPEEWPNLAYWFIQHKVYSPNMRWIIQVPRIYDIF
RSKKLLPNFGKMLENIFLPLFKATINPQDHRELHLFLKYVTGFDSVDDESKHSDHMFSDK
SPNPDVWTSEQNPPYSYYLYYMYANIMVLNNLRRERGLSTFLFRPHCGEAGSITHLVSAF
LTADNISHGLLLKKSPVLQYLYYLAQIPIAMSPLSNNSLFLEYSKNPLREFLHKGLHVSL
STDDPMQFHYTKEALMEEYAIAAQVWKLSTCDLCEIARNSVLQSGLSHQEKQKFLGQNYY
KEGPEGNDIRKTNVAQIRMAFRYETLCNELSFLSDAMKSEEITALTN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50087412
NameBDBM50087412
Synonyms:6-(8-Hydroxy-7,8-dihydro-6H-imidazo[4,5-d][1,3]diazepin-3-yl)-hexanoic acid | CHEMBL36690
TypeSmall organic molecule
Emp. Form.C12H18N4O3
Mol. Mass.266.2963
SMILESOC1CNC=Nc2c1ncn2CCCCCC(O)=O |c:4|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a