Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoamine oxidase
LigandBDBM50087801
Substrate/Competitorn/a
Meas. Tech.ChEMBL_123446
Ki 1.5±n/a nM
Citation Morón, JACampillo, MPerez, VUnzeta, MPardo, L Molecular determinants of MAO selectivity in a series of indolylmethylamine derivatives: biological activities, 3D-QSAR/CoMFA analysis, and computational simulation of ligand recognition. J Med Chem43:1684-91 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Monoamine oxidase
Name:Monoamine oxidase
Synonyms:Amine oxidase (flavin-containing) A | Amine oxidase [flavin-containing] A | Monoamine Oxidase Type A (MAO-A) | Monoamine oxidase A (MAO-A) | Monoamine oxidase A (rMAO-A) | Monoamine oxidase type A (MAOA)
Type:Enzyme
Mol. Mass.:59515.21
Organism:Rattus norvegicus (rat)
Description:n/a
Residue:526
Sequence:
MTDLEKPNLAGHMFDVGLIGGGISGLAAAKLLSEYKINVLVLEARDRVGGRTYTVRNEHV
KWVDVGGAYVGPTQNRILRLSKELGIETYKVNVNERLVQYVKGKTYPFRGAFPPVWNPLA
YLDYNNLWRTMDEMGKEIPVDAPWQARHAQEWDKMTMKDLIDKICWTKTAREFAYLFVNI
NVTSEPHEVSALWFLWYVRQCGGTARIFSVTNGGQERKFVGGSGQVSEQIMGLLGDKVKL
SSPVTYIDQTDDNIIVETLNHEHYECKYVISAIPPILTAKIHFKPELPPERNQLIQRLPM
GAVIKCMVYYKEAFWKKKDYCGCMIIEDEEAPIAITLDDTKPDGSLPAIMGFILARKADR
QAKLHKDIRKRKICELYAKVLGSQEALYPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGRIYFAGTETATQWSGYMEGAVEAGERAAREVLNALGKVAKKDIWVEEPESKD
VPAIEITHTFLERNLPSVPGLLKITGVSTSVALLCFVLYKIKKLPC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50087801
NameBDBM50087801
Synonyms:(5-Methoxy-1-methyl-1H-indol-2-ylmethyl)-methyl-prop-2-ynyl-amine | CHEMBL46898
TypeSmall organic molecule
Emp. Form.C15H18N2O
Mol. Mass.242.3162
SMILESCOc1ccc2n(C)c(CN(C)CC#C)cc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a