Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCollagenase
LigandBDBM50090364
Substrate/Competitorn/a
Meas. Tech.ChEMBL_104541
Ki 0.800000±n/a nM
Citation Salvino, JMMathew, RKiesow, TNarensingh, RMason, HJDodd, AGroneberg, RBurns, CJMcGeehan, GKline, JOrton, ETang, SYMorrisette, MLabaudininiere, R Solid-phase synthesis of an arylsulfone hydroxamate library. Bioorg Med Chem Lett10:1637-40 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Collagenase
Name:Matrix metalloproteinase 2/9
Synonyms:72 kDa gelatinase | 72 kDa type IV collagenase precursor | Gelatinase A | Gelatinase A (MMP-2) | Matrix metalloproteinase-2 | Matrix metalloproteinase-2 (MMP 2) | Matrix metalloproteinase-2 (MMP2) | Matrix metalloproteinases 2 (MMP-2) | TBE-1
Type:Enzyme
Mol. Mass.:73870.36
Organism:Homo sapiens (Human)
Description:
Residue:660
Sequence:
MEALMARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGC
PKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWD
KNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGD
GYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFN
GKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGT
SYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKY
ESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGAL
MAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQ
IRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEY
WIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDP
GFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50090364
NameBDBM50090364
Synonyms:3-[2-Hydroxycarbamoyl-1-(4-methoxy-benzenesulfonyl)-ethyl]-cyclohexanecarboxylic acid ethyl ester | CHEMBL40746
TypeSmall organic molecule
Emp. Form.C19H27NO7S
Mol. Mass.413.485
SMILESCCOC(=O)C1CCCC(C1)C(CC(=O)NO)S(=O)(=O)c1ccc(OC)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a