Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelatonin receptor
LigandBDBM50093266
Substrate/Competitorn/a
Meas. Tech.ChEMBL_105244
Ki 4.07±n/a nM
Citation Jellimann, CMathé-Allainmat, MAndrieux, JKloubert, SBoutin, JANicolas, JPBennejean, CDelagrange, PLanglois, M Synthesis of phenalene and acenaphthene derivatives as new conformationally restricted ligands for melatonin receptors. J Med Chem43:4051-62 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melatonin receptor
Name:Melatonin receptor
Synonyms:MTNR1B | Mel-1B-R | Mel1b melatonin receptor | Melatonin 1B | Melatonin receptor | Melatonin receptor type 1B | Melatonin receptor type 2 (MT2)
Type:Enzyme
Mol. Mass.:40203.54
Organism:Homo sapiens (Human)
Description:P49286
Residue:362
Sequence:
MSENGSFANCCEAGGWAVRPGWSGAGSARPSRTPRPPWVAPALSAVLIVTTAVDVVGNLL
VILSVLRNRKLRNAGNLFLVSLALADLVVAFYPYPLILVAIFYDGWALGEEHCKASAFVM
GLSVIGSVFNITAIAINRYCYICHSMAYHRIYRRWHTPLHICLIWLLTVVALLPNFFVGS
LEYDPRIYSCTFIQTASTQYTAAVVVIHFLLPIAVVSFCYLRIWVLVLQARRKAKPESRL
CLKPSDLRSFLTMFVVFVIFAICWAPLNCIGLAVAINPQEMAPQIPEGLFVTSYLLAYFN
SCLNAIVYGLLNQNFRREYKRILLALWNPRHCIQDASKGSHAEGLQSPAPPIIGVQHQAD
AL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50093266
NameBDBM50093266
Synonyms:CHEMBL131424 | N-(4-Methoxy-2,3-dihydro-1H-phenalen-1-ylmethyl)-butyramide
TypeSmall organic molecule
Emp. Form.C19H23NO2
Mol. Mass.297.3914
SMILESCCCC(=O)NCC1CCc2c(OC)ccc3cccc1c23
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a