Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target6-O-methylguanine-DNA methyltransferase
LigandBDBM5482
Substrate/Competitorn/a
Meas. Tech.ChEMBL_28280
IC50>1000000±n/a nM
Citation Griffin, RJArris, CEBleasdale, CBoyle, FTCalvert, AHCurtin, NJDalby, CKanugula, SLembicz, NKNewell, DRPegg, AEGolding, BT Resistance-modifying agents. 8. Inhibition of O(6)-alkylguanine-DNA alkyltransferase by O(6)-alkenyl-, O(6)-cycloalkenyl-, and O(6)-(2-oxoalkyl)guanines and potentiation of temozolomide cytotoxicity in vitro by O(6)-(1-cyclopentenylmethyl)guanine. J Med Chem43:4071-83 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
6-O-methylguanine-DNA methyltransferase
Name:6-O-methylguanine-DNA methyltransferase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:21651.27
Organism:Homo sapiens (Human)
Description:ChEMBL_144711
Residue:207
Sequence:
MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLM
QCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAAL
AGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPG
LGGSSGLAGAWLKGAGATSGSPPAGRN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM5482
NameBDBM5482
Synonyms:1-[(2-amino-9H-purin-6-yl)oxy]-3-methylbutan-2-one | CHEMBL272690 | O6-Substituted Guanine Deriv. 22
TypeSmall organic molecule
Emp. Form.C10H13N5O2
Mol. Mass.235.2425
SMILESCC(C)C(=O)COc1nc(N)nc2nc[nH]c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a