Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldehyde dehydrogenase (ALDH2)
LigandBDBM50093535
Substrate/Competitorn/a
Meas. Tech.ChEMBL_28556
IC50 3±n/a nM
Citation Rooke, NLi, DJLi, JKeung, WM The mitochondrial monoamine oxidase-aldehyde dehydrogenase pathway: a potential site of action of daidzin. J Med Chem43:4169-79 (2000) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Aldehyde dehydrogenase (ALDH2)
Name:Aldehyde dehydrogenase (ALDH2)
Synonyms:ALDH class 2 | ALDH-E2 | ALDHI | Aldehyde dehydrogenase, mitochondrial
Type:Enzyme
Mol. Mass.:56382.67
Organism:Homo sapiens (Human)
Description:P05091
Residue:517
Sequence:
MLRAAARFGPRLGRRLLSAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSRKTFPTVNPS
TGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLA
ALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCG
QIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPG
FGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNLKRVTLELGGKSPNIIMSDADM
DWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSKTEQGP
QVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTIAKEEIFGP
VMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQS
PFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50093535
n/a
NameBDBM50093535
Synonyms:11-(3-(4-hydroxyphenyl)-4-oxo-4H-chromen-7-yloxy)undecanoic acid | 11-[3-(4-Hydroxy-phenyl)-4-oxo-4H-chromen-7-yloxy]-undecanoic acid | CHEMBL113123
TypeSmall organic molecule
Emp. Form.C26H30O6
Mol. Mass.438.5128
SMILESOC(=O)CCCCCCCCCCOc1ccc2c(c1)occ(-c1ccc(O)cc1)c2=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: