Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 1A (5-HT1A)
LigandBDBM50094670
Substrate/Competitorn/a
Meas. Tech.ChEMBL_609
EC50 0.13±n/a nM
Citation Blair, JBKurrasch-Orbaugh, DMarona-Lewicka, DCumbay, MGWatts, VJBarker, ELNichols, DE Effect of ring fluorination on the pharmacology of hallucinogenic tryptamines. J Med Chem43:4701-10 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 1A (5-HT1A)
Name:5-hydroxytryptamine receptor 1A (5-HT1A)
Synonyms:5-HT-1A | 5-HT1A | 5-hydroxytryptamine receptor 1A | 5-hydroxytryptamine receptor 1A (5-HT-1A) | ADRB2RL1 | ADRBRL1 | Dopamine D2 receptor and serotonin 1a receptor | G-21 | HTR1A | Serotonin receptor 1A
Type:n/a
Mol. Mass.:46122.49
Organism:Homo sapiens (human)
Description:n/a
Residue:422
Sequence:
MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADT
RHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN
SKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50094670
NameBDBM50094670
Synonyms:1-(4-Dipropylamino-1,3,4,5-tetrahydro-benzo[cd]indol-6-yl)-ethanone | CHEMBL276031 | LY 293284 | LY-293284 | LY-293384
TypeSmall organic molecule
Emp. Form.C19H26N2O
Mol. Mass.298.4225
SMILESCCCN(CCC)C1Cc2c[nH]c3ccc(C(C)=O)c(C1)c23
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a