Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNorepinephrine transporter
LigandBDBM50010859
Substrate/Competitorn/a
Meas. Tech.ChEBML_142939
Ki 16±n/a nM
Citation Runyon, SPSavage, JETaroua, MRoth, BLGlennon, RAWestkaemper, RB Influence of chain length and N-alkylation on the selective serotonin receptor ligand 9-(aminomethyl)-9,10-dihydroanthracene. Bioorg Med Chem Lett11:655-8 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Norepinephrine transporter
Name:Norepinephrine transporter
Synonyms:Sodium-dependent noradrenaline transporter
Type:Enzyme Catalytic Domain
Mol. Mass.:69260.85
Organism:MOUSE
Description:Norepinephrine transporter 0 MOUSE::O55192
Residue:617
Sequence:
MLLARMNPQVQPELGGADPLPEQPLRPCKTADLLVVKERNGVQCLLASQDSDAQPRETWG
KKIDFLLSVVGFAVDLANVWRFPYLCYKNGGGAFLIPYTLFLIIAGMPLFYMELALGQYN
REGAATVWKICPFFKGVGYAVILIALYVGFYYNVIIAWSLYYLFASFTLNLPWTNCGHSW
NSPNCTDPKLLNASVLGDHTKYSKYKFTPAAEFYERGVLHLHESSGIHDIGLPQWQLLLC
LMVVIVVLYFSLWKGVKTSGKVVWITATLPYFVLFVLLVHGVTLPGASNGINAYLHIDFY
RLKEATVWIDAATQIFFSLGAGFGVLIAFASYNKFDNNCYRDALLTSTINCVTSFISGFA
IFSILGYMAHEHKVNIEDVATEGAGLVFILYPEAISTLSGSTFWAVLFFLMLLALGLDSS
MGGMEAVITGLADDFQVLKRHRKLFTCVVTISTFLLALFCITKGGIYVLTLLDTFAAGTS
ILFAVLMEAIGVSWFYGVDRFSNDIQQMMGFKPGLYWRLCWKFVSPAFLLFVVVVSIINF
KPLTYDDYTYPPWANWVGWGIALSSMILVPAYVIYKFLSIRGSLWERVAYGITPENEHHL
VAQRDVRQFQLRHWLAI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50010859
NameBDBM50010859
Synonyms:CHEMBL11 | IMIPRAMINE HYDROCHLORIDE | IMIPRAMINE PAMOATE | Imipramin
TypeSmall organic molecule
Emp. Form.C19H24N2
Mol. Mass.280.4073
SMILESCN(C)CCCN1c2ccccc2CCc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a