Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin receptor 2a and 2c (5HT2A and 5HT2C)
LigandBDBM50098534
Substrate/Competitorn/a
Meas. Tech.ChEMBL_2822
Ki 1.1±n/a nM
Citation Chambers, JJKurrasch-Orbaugh, DMParker, MANichols, DE Enantiospecific synthesis and pharmacological evaluation of a series of super-potent, conformationally restricted 5-HT(2A/2C) receptor agonists. J Med Chem44:1003-10 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Serotonin receptor 2a and 2c (5HT2A and 5HT2C)
Name:Serotonin (5-HT) receptor
Synonyms:5-HT2C | 5-hydroxytryptamine receptor 2C | 5-hydroxytryptamine receptor 2C (5HT2c) | HTR2C
Type:Enzyme
Mol. Mass.:51935.10
Organism:Rattus norvegicus (Rat)
Description:P08909
Residue:460
Sequence:
MVNLGNAVRSLLMHLIGLLVWQFDISISPVAAIVTDTFNSSDGGRLFQFPDGVQNWPALS
IVVIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYV
WPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVW
AISIGVSVPIPVIGLRDESKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYFLTIY
VLRRQTLMLLRGHTEEELANMSLNFLNCCCKKNGGEEENAPNPNPDQKPRRKKKEKRPRG
TMQAINNEKKASKVLGIVFFVFLIMWCPFFITNILSVLCGKACNQKLMEKLLNVFVWIGY
VCSGINPLVYTLFNKIYRRAFSKYLRCDYKPDKKPPVRQIPRVAATALSGRELNVNIYRH
TNERVARKANDPEPGIEMQVENLELPVNPSNVVSERISSV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50098534
NameBDBM50098534
Synonyms:2-(8-Bromo-2,3,6,7-tetrahydro-benzo[1,2-b;4,5-b']difuran-4-yl)-1-methyl-ethyl-ammonium; chloride | CHEMBL263078
TypeSmall organic molecule
Emp. Form.C13H17BrNO2
Mol. Mass.299.183
SMILESC[C@H]([NH3+])Cc1c2CCOc2c(Br)c2CCOc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a