Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-lactamase type II
LigandBDBM50099196
Substrate/Competitorn/a
Meas. Tech.ChEBML_48697
IC50>100000±n/a nM
Citation Sandanayaka, VPFeigelson, GBPrashad, ASYang, YPetersen, PJ Allyl and propargyl substituted penam sulfones as versatile intermediates toward the syntheses of new beta-lactamase inhibitors. Bioorg Med Chem Lett11:997-1000 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-lactamase type II
Name:Beta-lactamase type II
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:27252.87
Organism:Bacteroides fragilis
Description:ChEMBL_1502123
Residue:249
Sequence:
MKTVFILISMLFPVAVMAQKSVKISDDISITQLSDKVYTYVSLAEIEGWGMVPSNGMIVI
NNHQAALLDTPINDAQTEMLVNWVTDSLHAKVTTFIPNHWHGDCIGGLGYLQRKGVQSYA
NQMTIDLAKEKGLPVPEHGFTDSLTVSLDGMPLQCYYLGGGHATDNIVVWLPTENILFGG
CMLKDNQATSIGNISDADVTAWPKTLDKVKAKFPSARYVVPGHGDYGGTELIEHTKQIVN
QYIESTSKP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50099196
NameBDBM50099196
Synonyms:(2S,5R)-3,3-Dimethyl-4,4,7-trioxo-6-((E)-4-oxo-but-2-enyl)-4lambda*6*-thia-1-aza-bicyclo[3.2.0]heptane-2-carboxylic acid | CHEMBL6286
TypeSmall organic molecule
Emp. Form.C12H15NO6S
Mol. Mass.301.316
SMILESCC1(C)[C@@H](N2[C@@H](C(C\C=C\C=O)C2=O)S1(=O)=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a