Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuropeptide Y receptor type 1
LigandBDBM50409214
Substrate/Competitorn/a
Meas. Tech.ChEMBL_140783
Ki 0.07±n/a nM
Citation Balasubramaniam, ADhawan, VCMullins, DEChance, WTSheriff, SGuzzi, MPrabhakaran, MParker, EM Highly selective and potent neuropeptide Y (NPY) Y1 receptor antagonists based on [Pro(30), Tyr(32), Leu(34)]NPY(28-36)-NH2 (BW1911U90). J Med Chem44:1479-82 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Neuropeptide Y receptor type 1
Name:Neuropeptide Y receptor type 1
Synonyms:NPY-Y1 | NPY1-R | neuropeptide Y receptor Y1
Type:Enzyme Catalytic Domain
Mol. Mass.:44399.07
Organism:HUMAN
Description:NPY-Y1 NPY1R HUMAN::P25929
Residue:384
Sequence:
MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLA
LIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQ
CVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMT
DEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKR
RNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNL
LFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVS
KTSLKQASPVAFKKINNNDDNEKI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50409214
NameBDBM50409214
Synonyms:CHEMBL2110365 | GR-231118
TypeSmall organic molecule
Emp. Form.C110H170N34O24
Mol. Mass.2352.7402
SMILESCC[C@H](C)[C@H](N)C(=O)N[C@H]1CCC(=O)NC[C@H](NC(=O)[C@@H]2CCCN2C(=O)[C@H](CCC(=O)NC[C@H](NC(=O)[C@@H]2CCCN2C1=O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(N)=O)NC(=O)[C@@H](N)[C@@H](C)CC)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a