Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target3-dehydroquinate synthase
LigandBDBM26188
Substrate/Competitorn/a
Meas. Tech.ChEMBL_350
Ki 880000±n/a nM
Citation Chandran, SSFrost, JW Aromatic inhibitors of dehydroquinate synthase: synthesis, evaluation and implications for gallic acid biosynthesis. Bioorg Med Chem Lett11:1493-6 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
3-dehydroquinate synthase
Name:3-dehydroquinate synthase
Synonyms:n/a
Type:Enzyme
Mol. Mass.:38878.02
Organism:Escherichia coli (strain K12)
Description:P07639
Residue:362
Sequence:
MERIVVTLGERSYPITIASGLFNEPASFLPLKSGEQVMLVTNETLAPLYLDKVRGVLEQA
GVNVDSVILPDGEQYKSLAVLDTVFTALLQKPHGRDTTLVALGGGVVGDLTGFAAASYQR
GVRFIQVPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPASVVVDLDCLKTLPPRELAS
GLAEVIKYGIILDGAFFNWLEENLDALLRLDGPAMAYCIRRCCELKAEVVAADERETGLR
ALLNLGHTFGHAIEAEMGYGNWLHGEAVAAGMVMAARTSERLGQFSSAETQRIITLLKRA
GLPVNGPREMSAQAYLPHMLRDKKVLAGEMRLILPLAIGKSEVRSGVSHELVLNAIADCQ
SA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26188
NameBDBM26188
Synonyms:α-CA inhibitor, 12 | 1,2-Dihydroxybenzene, XI | 1,2-dihydroxybenzene | CHEMBL280998 | benzene-1,2-diol | phenol derivative, 2
TypeSmall organic molecule
Emp. Form.C6H6O2
Mol. Mass.110.1106
SMILESOc1ccccc1O
Structure
n/a