Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGABA receptor alpha-3/beta-3/gamma-2 subunit
LigandBDBM24183
Substrate/Competitorn/a
Meas. Tech.ChEMBL_70411
EC50 28000±n/a nM
Citation Ebert, BMortensen, MThompson, SAKehler, JWafford, KAKrogsgaard-Larsen, P Bioisosteric determinants for subtype selectivity of ligands for heteromeric GABA(A) receptors. Bioorg Med Chem Lett11:1573-7 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
GABA receptor alpha-3/beta-3/gamma-2 subunit
Name:GABA receptor alpha-3/beta-3/gamma-2 subunit
Synonyms:GABA-A receptor; alpha-3/beta-3/gamma-2
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of EBI is 68410
Components:This complex has 3 components.
Component 1
Name:GABA A receptor alpha-2/beta-2/gamma-2
Synonyms:GABA(A) receptor subunit gamma-2 | Gamma-aminobutyric acid receptor subunit gamma-2
Type:PROTEIN
Mol. Mass.:54172.74
Organism:Homo sapiens
Description:EBI_217
Residue:467
Sequence:
MSSPNIWSTGSSVYSTPVFSQKMTVWILLLLSLYPGFTSQKSDDDYEDYASNKTWVLTPK
VPEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQT
WYDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLY
TLRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVGDTRSWRLYQF
SFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDA
VPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSALVEYGTLHYFV
SNRKPSKDKDKKKKNPAPTIDIRPRSATIQMNNATHLQERDEEYGYECLDGKDCASFFCC
FEDCRTGAWRHGRIHIRIAKMDSYARIFFPTAFCLFNLVYWVSYLYL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Gamma-aminobutyric acid receptor subunit alpha-3/beta-3
Synonyms:GABA receptor beta-3 subunit | GABA-A receptor | agonist GABA site
Type:PROTEIN
Mol. Mass.:54130.51
Organism:Homo sapiens
Description:ChEMBL_448071
Residue:473
Sequence:
MWGLAGGRLFGIFSAPVLVAVVCCAQSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPP
VCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPD
TYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIE
SYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLK
RNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKI
PYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFGRGPQRQKKLAEKTAKAKNDRSKSESNR
VDAHGNILLTSLEVHNEMNEVSGGIGDTRNSAISFDNSGIQYRKQSMPREGHGRFLGDRS
LPHKKTHLRRRSSQLKIKIPDLTDVNAIDRWSRIVFPFTFSLFNLVYWLYYVN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 3
Name:GABA A receptor alpha-3/beta-2/gamma-2
Synonyms:GABA A Alpha3Beta3Gamma2 | GABA C | GABA receptor alpha-3 subunit | GABA-A receptor | Gamma-aminobutyric acid receptor subunit alpha-3 | agonist GABA site
Type:Enzyme Catalytic Domain
Mol. Mass.:55175.47
Organism:HUMAN
Description:GABA A Alpha3Beta1Gamma2 0 HUMAN::P34903
Residue:492
Sequence:
MIITQTSHCYMTSLGILFLINILPGTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDS
TDNITIFTRILDRLLDGYDNRLRPGLGDAVTEVKTDIYVTSFGPVSDTDMEYTIDVFFRQ
TWHDERLKFDGPMKILPLNNLLASKIWTPDTFFHNGKKSVAHNMTTPNKLLRLVDNGTLL
YTMRLTIHAECPMHLEDFPMDVHACPLKFGSYAYTTAEVVYSWTLGKNKSVEVAQDGSRL
NQYDLLGHVVGTEIIRSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLN
RESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVN
YFTKRSWAWEGKKVPEALEMKKKTPAAPAKKTSTTFNIVGTTYPINLAKDTEFSTISKGA
APSASSTPTIIASPKATYVQDSPTETKTYNSVSKVDKISRIIFPVLFAIFNLVYWATYVN
RESAIKGMIRKQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM24183
NameBDBM24183
Synonyms:4-amino-n-[2,3-3H]butyric acid | 4-aminobutanoic acid | Aminalon | CHEMBL96 | GABA | Gamma-Aminobutyric acid | [3H]GABA | cid_119
TypeRadiolabeled ligand
Emp. Form.C4H9NO2
Mol. Mass.103.1198
SMILESNCCCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a