Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanocortin receptor 5 (MC5R)
LigandBDBM50105882
Substrate/Competitorn/a
Meas. Tech.ChEMBL_220876
Ki 22±n/a nM
Citation Bednarek, MAMacNeil, TKalyani, RNTang, RVan der Ploeg, LHWeinberg, DH Selective, high affinity peptide antagonists of alpha-melanotropin action at human melanocortin receptor 4: their synthesis and biological evaluation in vitro. J Med Chem44:3665-72 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melanocortin receptor 5 (MC5R)
Name:Melanocortin receptor (M4 and M5)
Synonyms:MC-2 | MC5-R | MC5R | Melanocortin MC5 | Melanocortin receptor 5
Type:Enzyme
Mol. Mass.:36612.92
Organism:Homo sapiens (Human)
Description:P33032
Residue:325
Sequence:
MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDMGIAVEVFLTLGVISLLENILVIGA
IVKNKNLHSPMYFFVCSLAVADMLVSMSSAWETITIYLLNNKHLVIADAFVRHIDNVFDS
MICISVVASMCSLLAIAVDRYVTIFYALRYHHIMTARRSGAIIAGIWAFCTGCGIVFILY
SESTYVILCLISMFFAMLFLLVSLYIHMFLLARTHVKRIAALPGASSARQRTSMQGAVTV
TMLLGVFTVCWAPFFLHLTLMLSCPQNLYCSRFMSHFNMYLILIMCNSVMDPLIYAFRSQ
EMRKTFKEIICCRGFRIACSFPRRD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50105882
NameBDBM50105882
Synonyms:CHEMBL2370533 | Cyclo Ac-Cys-Glu-His-D-Phe-(3,4-di-Cl)-Arg-Trp-Gly-Cys-Pro-Pro-Lys-Asp-NH2
TypeSmall organic molecule
Emp. Form.C66H89Cl2N19O16S2
Mol. Mass.1539.567
SMILESCC(=O)N[C@@H]1CSSC[C@H](NC(=O)CNC(=O)[C@@H](Cc2c[nH]c3ccccc23)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](Cc2ccc(Cl)c(Cl)c2)NC(=O)[C@H](Cc2c[nH]cn2)NC(=O)[C@@H](CCC(O)=O)NC1=O)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CC(O)=O |wU:80.86,87.94,4.3,55.58,42.44,99.106,31.33,wD:9.78,90.102,17.17,65.69,(.52,-47.47,;1.54,-48.61,;1.05,-50.07,;3.03,-48.31,;3.52,-46.84,;5.04,-47.16,;6.57,-47.1,;8.05,-46.66,;9.39,-45.89,;10.5,-44.84,;11.32,-43.53,;11.81,-42.07,;13.32,-42.38,;11.93,-40.54,;11.69,-39.02,;11.09,-37.6,;12.42,-36.83,;10.16,-36.37,;11.27,-35.3,;12.74,-35.72,;13.97,-34.78,;15.23,-35.65,;14.81,-37.13,;15.63,-38.43,;14.9,-39.79,;13.35,-39.84,;12.55,-38.53,;13.27,-37.18,;8.97,-35.39,;7.57,-34.73,;8.06,-33.27,;6.06,-34.41,;6.19,-32.88,;7.57,-32.23,;7.71,-30.69,;9.1,-30.03,;9.23,-28.49,;10.62,-27.83,;7.95,-27.62,;4.52,-34.48,;3.05,-34.9,;2.45,-33.5,;1.71,-35.69,;.79,-34.45,;.78,-32.92,;2.1,-32.13,;2.1,-30.6,;.75,-29.85,;.73,-28.31,;-.57,-30.63,;-1.91,-29.87,;-.55,-32.16,;.61,-36.74,;-.22,-38.05,;-1.62,-37.39,;-.71,-39.51,;-2.23,-39.21,;-2.7,-37.74,;-1.81,-36.49,;-2.72,-35.25,;-4.18,-35.74,;-4.18,-37.28,;-.83,-41.05,;-.58,-42.56,;-2.06,-43,;.02,-43.98,;-1.32,-44.75,;-2.65,-43.98,;-3.98,-44.75,;-5.32,-43.98,;-3.98,-46.29,;.94,-45.22,;2.14,-46.19,;1.31,-47.49,;11.69,-45.8,;11.44,-47.33,;13.14,-45.26,;13.04,-43.73,;14.49,-43.18,;15.44,-44.38,;14.62,-45.66,;15.16,-47.1,;14.2,-48.29,;16.69,-47.33,;16.61,-45.8,;18.04,-45.24,;19,-46.44,;18.17,-47.73,;18.93,-49.06,;18.16,-50.38,;20.47,-49.06,;21.24,-47.73,;20.47,-46.39,;21.24,-45.07,;20.47,-43.73,;21.25,-42.4,;21.23,-50.38,;22.77,-50.38,;23.54,-49.06,;23.53,-51.73,;25.07,-51.73,;22.75,-53.04,;23.52,-54.39,;22.75,-55.71,;25.06,-54.39,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a