Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVoltage-gated potassium channel subunit Kv7.1
LigandBDBM50106167
Substrate/Competitorn/a
Meas. Tech.ChEMBL_158397
IC50 23±n/a nM
Citation Lloyd, JSchmidt, JBRovnyak, GAhmad, SAtwal, KSBisaha, SNDoweyko, LMStein, PDTraeger, SCMathur, AConder, MLDiMarco, JHarper, TWJenkins-West, TLevesque, PCNormandin, DERussell, ADSerafino, RPSmith, MALodge, NJ Design and synthesis of 4-substituted benzamides as potent, selective, and orally bioavailable I(Ks) blockers. J Med Chem44:3764-7 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Voltage-gated potassium channel subunit Kv7.1
Name:Voltage-gated potassium channel subunit Kv7.1
Synonyms:IKs producing slow voltage-gated potassium channel subunit alpha KvLQT1 | KQT-like 1 | Potassium voltage-gated channel subfamily KQT member 1
Type:PROTEIN
Mol. Mass.:74450.11
Organism:Cavia porcellus
Description:ChEMBL_88894
Residue:671
Sequence:
MAAASSPPRTERKRGGWGRLLGSRRGSASLAKKCPFSLELAEGGPAGGTLYAPVAPPGAL
SPGSPAPPASPAAPPAGLELGPRPPVSLDPRVSIYSARRPLLARTHIQGRVYNFLERPTG
WKCFVYHFAVFLIVLACLIFSVLSTIEQYAALATGTLFWMEIVLVVFFGTEYVVRLWSAG
CRSKYVGIWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRML
HVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVNESGRVEFGSY
ADALWWGVVTVTTIGYGDKVPQTWVGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQ
RQKHFNRQIPAAASLIQTAWRCYAAENPDSSTWKIYVRKPARSHTLLSPSPKPKKSAMVR
KKKFKPDKDNGVSPGEKMLTVPHITCDPPEERRPDHFSVDGYDSSVRKSPTLLEVSPTHF
MRTNSFAEDLDLEGETLLTPITHVSQLREHHRATIKVIRRMQYFVAKKKFQQARKPYDVR
DVIEQYSQGHLNLMVRIKELQRRLDQSIGKPSLFIPISEKSKDRGSNTIGARLNRVEDKV
TQLDQRLVVITDMLHQLLSLHQGGPHSGGGPQMVQPCSEDGSIHPELFLPSNSLPTYEQL
TVPQRGPDEAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50106167
NameBDBM50106167
Synonyms:CHEMBL125000 | Enantiomer-4-(3-Cyclopropylmethyl-[1,2,4]oxadiazol-5-yl)-N-(2,2-dimethyl-cyclopentylmethyl)-benzamide
TypeSmall organic molecule
Emp. Form.C21H27N3O2
Mol. Mass.353.458
SMILESCC1(C)CCCC1CNC(=O)c1ccc(cc1)-c1nc(CC2CC2)no1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a