Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin (5-HT) receptor
LigandBDBM50107249
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1125
Ki 0.16±n/a nM
Citation Perrone, RBerardi, FColabufo, NALeopoldo, MLacivita, ETortorella, VLeonardi, APoggesi, ETesta, R trans-4-[4-(Methoxyphenyl)cyclohexyl]-1-arylpiperazines: a new class of potent and selective 5-HT(1A) receptor ligands as conformationally constrained analogues of 4-[3-(5-methoxy-1,2,3,4-tetrahydronaphthalen-1-yl)propyl]-1-arylpiperazines. J Med Chem44:4431-42 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serotonin (5-HT) receptor
Name:Serotonin 1 (5-HT1) receptor
Synonyms:5-HT-1A | 5-HT1 | 5-HT1A | 5-Hydroxytryptamine receptor 1A (5-HT1A) | 5-hydroxytryptamine receptor 1A | 5-hydroxytryptamine receptor 1A (5HT1A) | G-21 | Serotonin 1a (5-HT1a) receptor/Adrenergic receptor alpha-1 | Serotonin receptor 1A
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:46445.29
Organism:Rattus norvegicus (rat)
Description:Binding assays were performed using rat hippocampal membranes.
Residue:422
Sequence:
MDVFSFGQGNNTTASQEPFGTGGNVTSISDVTFSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVRKVEKKGAGT
SLGTSSAPPPKKSLNGQPGSGDWRRCAENRAVGTPCTNGAVRQGDDEATLEVIEVHRVGN
SKEHLPLPSESGSNSYAPACLERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPALLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50107249
NameBDBM50107249
Synonyms:1-[2-(7-Methoxy-1,2,3,4-tetrahydro-naphthalen-2-yl)-ethyl]-4-pyridin-2-yl-piperazine | CHEMBL423181
TypeSmall organic molecule
Emp. Form.C22H29N3O
Mol. Mass.351.4852
SMILESCOc1ccc2CCC(CCN3CCN(CC3)c3ccccn3)Cc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a