Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNitric-oxide synthase, brain
LigandBDBM50108561
Substrate/Competitorn/a
Meas. Tech.ChEMBL_143505
IC50>1000000±n/a nM
Citation Camacho, ELeón, JCarrión, AEntrena, AEscames, GKhaldy, HAcuña-Castroviejo, DGallo, MAEspinosa, A Inhibition of nNOS activity in rat brain by synthetic kynurenines: structure-activity dependence. J Med Chem45:263-74 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Nitric-oxide synthase, brain
Name:Nitric-oxide synthase, brain
Synonyms:N-NOS | NC-NOS | NOS | NOS type I nNOS | Neuronal nitric oxide synthase | Neuronal nitric oxide synthase (nNOS) | Nitric Oxide Synthase, brain | Nitric oxide synthase (nNOS) | Nitric oxide synthase, brain (nNOS) | Nitrogen oxide synthase - neuronal | Peptidyl-cysteine S-nitrosylase NOS1
Type:Enzyme
Mol. Mass.:160570.98
Organism:Rattus norvegicus (rat)
Description:Recombinant nNOS overexpressed in E. coli was used in enzyme assays.
Residue:1429
Sequence:
MEENTFGVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQA
GDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTI
RVTQPLGPPTKAVDLSHQPSASKDQSLAVDRVTGLGNGPQHAQGHGQGAGSVSQANGVAI
DPTMKSTKANLQDIGEHDELLKEIEPVLSILNSGSKATNRGGPAKAEMKDTGIQVDRDLD
GKSHKAPPLGGDNDRVFNDLWGKDNVPVILNNPYSEKEQSPTSGKQSPTKNGSPSRCPRF
LKVKNWETDVVLTDTLHLKSTLETGCTEHICMGSIMLPSQHTRKPEDVRTKDQLFPLAKE
FLDQYYSSIKRFGSKAHMDRLEEVNKEIESTSTYQLKDTELIYGAKHAWRNASRCVGRIQ
WSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGKHDFRVWNSQLI
RYAGYKQPDGSTLGDPANVQFTEICIQQGWKAPRGRFDVLPLLLQANGNDPELFQIPPEL
VLEVPIRHPKFDWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGVRDYCD
NSRYNILEEVAKKMDLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSATESFIK
HMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQPDPWNTHVWKGTN
GTPTKRRAIGFKKLAEAVKFSAKLMGQAMAKRVKATILYATETGKSQAYAKTLCEIFKHA
FDAKAMSMEEYDIVHLEHEALVLVVTSTFGNGDPPENGEKFGCALMEMRHPNSVQEERKS
YKVRFNSVSSYSDSRKSSGDGPDLRDNFESTGPLANVRFSVFGLGSRAYPHFCAFGHAVD
TLLEELGGERILKMREGDELCGQEEAFRTWAKKVFKAACDVFCVGDDVNIEKPNNSLISN
DRSWKRNKFRLTYVAEAPDLTQGLSNVHKKRVSAARLLSRQNLQSPKFSRSTIFVRLHTN
GNQELQYQPGDHLGVFPGNHEDLVNALIERLEDAPPANHVVKVEMLEERNTALGVISNWK
DESRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATNEKEKQRLLVLSKGLQEYEEWKW
GKNPTMVEVLEEFPSIQMPATLLLTQLSLLQPRYYSISSSPDMYPDEVHLTVAIVSYHTR
DGEGPVHHGVCSSWLNRIQADDVVPCFVRGAPSFHLPRNPQVPCILVGPGTGIAPFRSFW
QQRQFDIQHKGMNPCPMVLVFGCRQSKIDHIYREETLQAKNKGVFRELYTAYSREPDRPK
KYVQDVLQEQLAESVYRALKEQGGHIYVCGDVTMAADVLKAIQRIMTQQGKLSEEDAGVF
ISRLRDDNRYHEDIFGVTLRTYEVTNRLRSESIAFIEESKKDADEVFSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50108561
NameBDBM50108561
Synonyms:4-(2-Amino-5-methoxy-phenyl)-2-butyrylamino-4-oxo-butyric acid | CHEMBL421175
TypeSmall organic molecule
Emp. Form.C15H20N2O5
Mol. Mass.308.3297
SMILESCCCC(=O)NC(CC(=O)c1cc(OC)ccc1N)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a