Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhospholipase A2 group 1VB
LigandBDBM50110846
Substrate/Competitorn/a
Meas. Tech.ChEMBL_156209
IC50 8±n/a nM
Citation Connolly, SBennion, CBotterell, SCroshaw, PJHallam, CHardy, KHartopp, PJackson, CGKing, SJLawrence, LMete, AMurray, DRobinson, DHSmith, GMStein, LWalters, IWells, EWithnall, WJ Design and synthesis of a novel and potent series of inhibitors of cytosolic phospholipase A(2) based on a 1,3-disubstituted propan-2-one skeleton. J Med Chem45:1348-62 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Phospholipase A2 group 1VB
Name:Phospholipase A2 group 1VB
Synonyms:Cytosolic phospholipase A2 beta | Phospholipase A2 group IVB | cPLA2-beta
Type:PROTEIN
Mol. Mass.:87967.69
Organism:Homo sapiens (Human)
Description:ChEMBL_156210
Residue:781
Sequence:
MAVAEVSRTCLLTVRVLQAHRLPSKDLVTPSDCYVTLWLPTACSHRLQTRTVKNSSSPVW
NQSFHFRIHRQLKNVMELKVFDQDLVTGDDPVLSVLFDAGTLRAGEFRRESFSLSPQGEG
RLEVEFRLQSLADRGEWLVSNGVLVARELSCLHVQLEETGDQKSSEHRVQLVVPGSCEGP
QEASVGTGTFRFHCPACWEQELSIRLQDAPEEQLKAPLSALPSGQVVRLVFPTSQEPLMR
VELKKEAGLRELAVRLGFGPCAEEQAFLSRRKQVVAAALRQALQLDGDLQEDEIPVVAIM
ATGGGIRAMTSLYGQLAGLKELGLLDCVSYITGASGSTWALANLYEDPEWSQKDLAGPTE
LLKTQVTKNKLGVLAPSQLQRYRQELAERARLGYPSCFTNLWALINEALLHDEPHDHKLS
DQREALSHGQNPLPIYCALNTKGQSLTTFEFGEWCEFSPYEVGFPKYGAFIPSELFGSEF
FMGQLMKRLPESRICFLEGIWSNLYAANLQDSLYWASEPSQFWDRWVRNQANLDKEQVPL
LKIEEPPSTAGRIAEFFTDLLTWRPLAQATHNFLRGLHFHKDYFQHPHFSTWKATTLDGL
PNQLTPSEPHLCLLDVGYLINTSCLPLLQPTRDVDLILSLDYNLHGAFQQLQLLGRFCQE
QGIPFPPISPSPEEQLQPRECHTFSDPTCPGAPAVLHFPLVSDSFREYSAPGVRRTPEEA
AAGEVNLSSSDSPYHYTKVTYSQEDVDKLLHLTHYNVCNNQEQLLEALRQAVQRRRQRRP
H
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50110846
NameBDBM50110846
Synonyms:4-(3-(4-(decyloxy)phenoxy)-2-oxopropoxy)benzoic acid | 4-[3-(4-Decyloxy-phenoxy)-2-oxo-propoxy]-benzoic acid | 4-[3-(4-Decyloxy-phenoxy)-2-oxo-propoxy]-benzoic acid(AR-C70484XX) | CHEMBL30108
TypeSmall organic molecule
Emp. Form.C26H34O6
Mol. Mass.442.5446
SMILESCCCCCCCCCCOc1ccc(OCC(=O)COc2ccc(cc2)C(O)=O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a