Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOxytocin receptor
LigandBDBM50219775
Substrate/Competitorn/a
Meas. Tech.ChEMBL_149054
Ki 3.2±n/a nM
Citation Wyatt, PGAllen, MJChilcott, JGardner, CJLivermore, DGMordaunt, JENerozzi, FPatel, MPerren, MJWeingarten, GGShabbir, SWoollard, PMZhou, P Identification of potent and selective oxytocin antagonists. Part 2: further investigation of benzofuran derivatives. Bioorg Med Chem Lett12:1405-11 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Oxytocin receptor
Name:Oxytocin receptor
Synonyms:OT-R | Oxytocin
Type:Enzyme Catalytic Domain
Mol. Mass.:42793.26
Organism:HEK293
Description:Oxytocin OXTR HEK293::B2R9L7
Residue:389
Sequence:
MEGALAANWSAEAANASAAPPGAEGNRTAGPPRRNEALARVEVAVLCLILLLALSGNACV
LLALRTTRQKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV
VGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVLATWLGCLVASAPQVHIFSLREV
ADGVFDCWAVFIQPWGPKAYITWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTAAAAA
AEAPEGAAAGDGGRVALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVW
DANAPKEASAFIIVMLLASLNSCCNPWIYMLFTGHLFHELVQRFLCCSASYLKGRRLGET
SASKKSNSSSFVLSHRSSSQRSCSQPSTA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50219775
NameBDBM50219775
Synonyms:CHEMBL31651
TypeSmall organic molecule
Emp. Form.C31H26ClF3N4O6
Mol. Mass.643.01
SMILESFC(F)(F)c1ccc(=O)n(CC(=O)NCc2cc3cc(ccc3o2)C(=O)N2CCC(CC2)N2C(=O)OCc3ccc(Cl)cc23)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a