Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin receptor 2a and 2c (5HT2A and 5HT2C)
LigandBDBM50115831
Substrate/Competitorn/a
Meas. Tech.ChEMBL_2832
Ki 0.9±n/a nM
Citation Chambers, JJKurrasch-Orbaugh, DMNichols, DE Translocation of the 5-alkoxy substituent of 2,5-dialkoxyarylalkylamines to the 6-position: effects on 5-HT(2A/2C) receptor affinity. Bioorg Med Chem Lett12:1997-9 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Serotonin receptor 2a and 2c (5HT2A and 5HT2C)
Name:Serotonin (5-HT) receptor
Synonyms:5-HT2C | 5-hydroxytryptamine receptor 2C | 5-hydroxytryptamine receptor 2C (5HT2c) | HTR2C
Type:Enzyme
Mol. Mass.:51935.10
Organism:Rattus norvegicus (Rat)
Description:P08909
Residue:460
Sequence:
MVNLGNAVRSLLMHLIGLLVWQFDISISPVAAIVTDTFNSSDGGRLFQFPDGVQNWPALS
IVVIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYV
WPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVW
AISIGVSVPIPVIGLRDESKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYFLTIY
VLRRQTLMLLRGHTEEELANMSLNFLNCCCKKNGGEEENAPNPNPDQKPRRKKKEKRPRG
TMQAINNEKKASKVLGIVFFVFLIMWCPFFITNILSVLCGKACNQKLMEKLLNVFVWIGY
VCSGINPLVYTLFNKIYRRAFSKYLRCDYKPDKKPPVRQIPRVAATALSGRELNVNIYRH
TNERVARKANDPEPGIEMQVENLELPVNPSNVVSERISSV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50115831
NameBDBM50115831
Synonyms:1-Methyl-2-(4-methyl-benzo[1,2-b;5,4-b']difuran-8-yl)-ethylamine | CHEMBL304636
TypeSmall organic molecule
Emp. Form.C14H15NO2
Mol. Mass.229.2744
SMILESCC(N)Cc1c2occc2c(C)c2ccoc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a