Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGranzyme B
LigandBDBM50116257
Substrate/Competitorn/a
Meas. Tech.ChEMBL_72172
Ki 270±n/a nM
Citation Willoughby, CABull, HGGarcia-Calvo, MJiang, JChapman, KTThornberry, NA Discovery of potent, selective human granzyme B inhibitors that inhibit CTL mediated apoptosis. Bioorg Med Chem Lett12:2197-200 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Granzyme B
Name:Granzyme B
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:27735.56
Organism:Homo sapiens
Description:ChEMBL_469245
Residue:247
Sequence:
MQPILLLLAFLLLPRADAGEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVL
TAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKR
TRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHY
YDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWI
KKTMKRY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50116257
NameBDBM50116257
Synonyms:3-[((S)-{1-[(S)-2-((3S,4S)-2-Acetylamino-3-methyl-pentanoylamino)-acetyl]-pyrrolidin-2-yl}-oxo-methyl)-amino]-4-oxo-butyric acid | CHEMBL69424
TypeSmall organic molecule
Emp. Form.C19H30N4O7
Mol. Mass.426.4641
SMILESCC[C@H](C)[C@H](NC(C)=O)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(O)=O)C=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a