Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGranzyme B
LigandBDBM50116264
Substrate/Competitorn/a
Meas. Tech.ChEMBL_72172
Ki 7±n/a nM
Citation Willoughby, CABull, HGGarcia-Calvo, MJiang, JChapman, KTThornberry, NA Discovery of potent, selective human granzyme B inhibitors that inhibit CTL mediated apoptosis. Bioorg Med Chem Lett12:2197-200 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Granzyme B
Name:Granzyme B
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:27735.56
Organism:Homo sapiens
Description:ChEMBL_469245
Residue:247
Sequence:
MQPILLLLAFLLLPRADAGEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVL
TAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKR
TRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHY
YDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWI
KKTMKRY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50116264
NameBDBM50116264
Synonyms:(S)-3-({(S)-(S)-5-[(S)-2-((S)-Acetyl-methyl-amino)-3-methyl-pentanoylamino]-4-oxo-1,2,4,5,6,7-hexahydro-azepino[3,2,1-hi]indole-2-carbonyl}-amino)-4-oxo-4-(5-phenyl-[1,3,4]oxadiazol-2-yl)-butyric acid | CHEMBL71654
TypeSmall organic molecule
Emp. Form.C34H38N6O8
Mol. Mass.658.7009
SMILESCC[C@H](C)[C@H](N(C)C(C)=O)C(=O)N[C@H]1CCc2cccc3C[C@H](N(c23)C1=O)C(=O)N[C@@H](CC(O)=O)C(=O)c1nnc(o1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a